SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mnmC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mnmC
Domain Number 1 Region: 16-86
Classification Level Classification E-value
Superfamily Homeodomain-like 2.17e-17
Family Homeodomain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mnmC   PDB: 1mnm   SUPERFAMILY: 1mnmC
Sequence length 87
Comment (C:)
Sequence
qltqknksadglvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkgl
enlmkntslsriqiknwvsnrrrkekt
Download sequence
Identical sequences 1mnmC cath|current|1mnmC00/113-189 cath|current|1mnmD00/113-189 1mnm_C 1mnm_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]