SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1moqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1moqA
Domain Number 1 Region: 4-357
Classification Level Classification E-value
Superfamily SIS domain 5.62e-219
Family double-SIS domain 0.00000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1moqA   PDB: 1moq   SUPERFAMILY: 1moqA
Sequence length 368
Comment (A:)
Sequence
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve
Download sequence
Identical sequences 1moqA d2bpja2 d2bpjb2 d2j6ha1 d2j6hb1 d3ooja2 d3oojb2 d3oojh2 1moq_A 1mor_A 1mos_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]