SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mp1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mp1A
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily PWI domain 3.73e-46
Family PWI domain 0.000000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mp1A   PDB: 1mp1   SUPERFAMILY: 1mp1A
Sequence length 111
Comment (A:)
Sequence
shmqlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdsk
mmqinltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr
Download sequence
Identical sequences 000003061|e1mp1A1|592.1.1.1|A:1-111 cath|current|1mp1A00/24-134 1mp1_A 1mp1A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]