SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mp9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mp9A
Domain Number 1 Region: 104-182
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.53e-42
Family TATA-box binding protein (TBP), C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 15-93
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.55e-38
Family TATA-box binding protein (TBP), C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mp9A   PDB: 1mp9
Sequence length 198
Comment (A:)
Sequence
yiipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkit
slifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivn
ldkaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifd
klveldcvkpveeeelef
Download sequence
Identical sequences 1mp9A 1mp9_A 1mp9_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]