SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mufA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mufA
Domain Number 1 Region: 114-257
Classification Level Classification E-value
Superfamily SET domain 5.2e-38
Family Histone lysine methyltransferases 0.000000118
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.83e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mufA   PDB: 1muf
Sequence length 257
Comment (A:)
Sequence
vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhfdkstssc
istnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithqevdsrdw
alngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprfgpikcir
tlraveadeeltvaygy
Download sequence
Identical sequences 1muf_A 1mufA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]