SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1n9wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1n9wA
Domain Number 1 Region: 95-421
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.44e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000149
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.62e-20
Family Anticodon-binding domain 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1n9wA   PDB: 1n9w
Sequence length 422
Comment (A:)
Sequence
MRVLVRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGLKLPLPESALR
VRGLVVENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRYVTLRGEK
ARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQ
LYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIADEEDLMRLEEALLAE
MLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLG
EYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELL
ESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRL
TP
Download sequence
Identical sequences Q5SIC2
1n9w_A 1n9w_B 3kfu_A 3kfu_B 3kfu_C 3kfu_D 300852.TTHA1452 YP_144718.1.19876 1n9wA gi|55981421|ref|YP_144718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]