SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nayA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nayA
Domain Number 1 Region: 28-56
Classification Level Classification E-value
Superfamily Fibritin 0.00000000000000469
Family Fibritin 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nayA   PDB: 1nay   SUPERFAMILY: 1nayA
Sequence length 56
Comment (A:)
Sequence
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
Download sequence
Identical sequences 1nay_A 1nay_B 1nay_C 1nayA cath|current|1nayA00/106-161 cath|current|1nayB00/207-261 cath|current|1nayC00/306-361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]