SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nd6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nd6A
Domain Number 1 Region: 2-328
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.33e-127
Family Histidine acid phosphatase 0.00000000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nd6A   PDB: 1nd6   SUPERFAMILY: 1nd6A
Sequence length 354
Comment (A:)
Sequence
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
Download sequence
Identical sequences cath|current|1nd5A00/1-342 cath|current|1nd5B00/1000-1341 cath|current|1nd5C00/2000-2341 cath|current|1nd5D00/3000-3341 cath|current|1nd6A00/1-342 cath|current|1nd6B00/1000-1342 cath|current|1nd6C00/2000-2341 cath|current|1nd6D00/3000-3341 1nd5_A 1nd5_B 1nd5_C 1nd5_D 1nd6_A 1nd6_B 1nd6_C 1nd6_D 1nd6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]