SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1neeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1neeA
Domain Number 1 Region: 6-100
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 1.24e-40
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 102-132
Classification Level Classification E-value
Superfamily Zinc-binding domain of translation initiation factor 2 beta 4.9e-16
Family Zinc-binding domain of translation initiation factor 2 beta 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1neeA   PDB: 1nee
Sequence length 138
Comment (A:)
Sequence
gshmddyeklleraidqlppevfetkrfevpkaysviqgnrtfiqnfrevadalnrdpqh
llkfllrelgtagnleggrailqgkfthflineriedyvnkfvichecnrpdtriiregr
isllkceacgakaplknv
Download sequence
Identical sequences 1neeA 1nee_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]