SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nexA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nexA
Domain Number 1 Region: 109-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.86e-44
Family Skp1 dimerisation domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily POZ domain 4.14e-25
Family BTB/POZ domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nexA   PDB: 1nex
Sequence length 169
Comment (A:)
Sequence
gahmvtsnvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrss
vlqkviewaehhrdsnfpdeddddsrksapvdswdreflkvdqemlyeiilaanylnikp
lldagckvvaemirgrspeeirrtfnivndftpeeeaairrenewaedr
Download sequence
Identical sequences cath|current|3mksA00/4-185 cath|current|3mksC00/4-186 cath|current|3v7dA00/3-188 cath|current|3v7dC00/4-188 1nex_A 1nex_C 3mks_A 3mks_C 3v7d_A 3v7d_C 1nexA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]