SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nfgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nfgA
Domain Number 1 Region: 49-392
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.68e-126
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00000000000776
Further Details:      
 
Domain Number 2 Region: 2-42,367-431
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 9.87e-37
Family Hydantoinase (dihydropyrimidinase) 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nfgA   PDB: 1nfg
Sequence length 457
Comment (A:)
Sequence
MDIIIKNGTIVTADGISRADLGIKDGKITQIGGALGPAERTIDAAGRYVFPGGIDVHTHV
ETVSFNTQSADTFATATVAAACGGTTTIVDFCQQDRGHSLAEAVAKWDGMAGGKSAIDYG
YHIIVLDPTDSVIEELEVLPDLGITSFKVFMAYRGMNMIDDVTLLKTLDKAVKTGSLVMV
HAENGDAADYLRDKFVAEGKTAPIYHALSRPPRVEAEATARALALAEIVNAPIYIVHVTC
EESLEEVMRAKSRGVRALAETCTHYLYLTKEDLERPDFEGAKYVFTPPARAKKDHDVLWN
ALRNGVFETVSSDHCSWLFKGHKDRGRNDFRAIPNGAPGVEERLMMVYQGVNEGRISLTQ
FVELVATRPAKVFGMFPQKGTIAVGSDADIVLWDPEAEMVIEQTAMHNAMDYSSYEGHKV
KGVPKTVLLRGKVIVDEGSYVGEPTDGKFLKRRKYKQ
Download sequence
Identical sequences Q2MKJ8 Q400N8 Q8VTT5
1nfgA 1nfg_A 1nfg_B 1nfg_C 1nfg_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]