SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nhcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nhcA
Domain Number 1 Region: 26-331
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.41e-111
Family Galacturonase 0.000000000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nhcA   PDB: 1nhc   SUPERFAMILY: 1nhcA
Sequence length 336
Comment (A:)
Sequence
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
Download sequence
Identical sequences 1nhcA cath|current|1nhcA00/33-368 cath|current|1nhcB00/33-368 cath|current|1nhcC00/33-368 cath|current|1nhcD00/33-368 cath|current|1nhcE00/33-368 cath|current|1nhcF00/33-368 d1nhca_ d1nhcb_ d1nhcc_ d1nhcd_ d1nhce_ d1nhcf_ 1nhc_A 1nhc_B 1nhc_C 1nhc_D 1nhc_E 1nhc_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]