SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ni4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ni4A
Domain Number 1 Region: 24-358
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.32e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ni4A   PDB: 1ni4   SUPERFAMILY: 1ni4A
Sequence length 365
Comment (A:)
Sequence
mrgsfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqk
iirgfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggc
akgkggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqif
eaynmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvrea
trfaaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmv
nsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwik
fksvs
Download sequence
Identical sequences 1ni4_A 1ni4_C 6cfo_A 6cfo_C 1ni4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]