SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ni5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ni5A
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.3e-65
Family PP-loop ATPase 0.00000000167
Further Details:      
 
Domain Number 2 Region: 319-427
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.34e-32
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.000000583
Further Details:      
 
Domain Number 3 Region: 228-313
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.34e-26
Family MesJ substrate recognition domain-like 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ni5A   PDB: 1ni5
Sequence length 433
Comment (A:)
Sequence
smtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanada
wvthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhldd
qcetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedes
nqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldelladdlahcqspqg
tlqivpmlamsdarraaiirrwlagqnapmpsrdalvriwqevalaredaspclrlgafe
irryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlnaggdirppradeavsvr
fkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetliaaagvfvtqegvaeg
engvsfvwqktls
Download sequence
Identical sequences 1ni5_A 1ni5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]