SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nj1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nj1A
Domain Number 1 Region: 40-303
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.72e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000188
Further Details:      
 
Domain Number 2 Region: 305-428
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.38e-34
Family Anticodon-binding domain of Class II aaRS 0.000000604
Further Details:      
 
Domain Number 3 Region: 432-501
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.04e-19
Family C-terminal domain of ProRS 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nj1A   PDB: 1nj1
Sequence length 501
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmqkpikkdpnryhgekmtefsewfhnileeaeiidqrypv
kgmhvwmphgfmirkntlkilrrildrdheevlfpllvpedelakeaihvkgfedevywv
thgglsklqrklalrptsetvmypmfalwvrshtdlpmrfyqvvntfryetkhtrplirv
reittfkeahtihataseaeeqveraveiykeffnslgipylitrrppwdkfpgseytva
fdtlmpdgktlqigtvhnlgqtfartfeikfetpegdheyvhqtcyglsdrviasviaih
gdesglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragr
kyyewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlr
trawermeseireaetleeasrivdekrgiisfmwcgeeecgmdveekvrvdilgiqeeg
sgtcincgreapyraylarty
Download sequence
Identical sequences 1nj1_A 1nj2_A 1nj5_A 1nj6_A 1nj1A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]