SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nj8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nj8A
Domain Number 1 Region: 7-271
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.01e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000176
Further Details:      
 
Domain Number 2 Region: 272-396
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.56e-38
Family Anticodon-binding domain of Class II aaRS 0.000000556
Further Details:      
 
Domain Number 3 Region: 398-459
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.65e-28
Family C-terminal domain of ProRS 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nj8A   PDB: 1nj8
Sequence length 459
Comment (A:)
Sequence
gshmlefsewysdilekaeiydvrypikgcgvylpygfkirrytfeiirnlldesghdea
lfpmlipedllakeaehikgfedevywvthggktqldvklalrptsetpiyymmklwvkv
htdlpikiyqivntfryetkhtrplirlreimtfkeahtahstkeeaenqvkeaisiykk
ffdtlgipyliskrpewdkfpgaeytmafdtifpdgrtmqiatvhnlgqnfsktfeiife
tptgdkdyayqtcygisdrviasiiaihgdekglilppivapiqvvivplifkgkedivm
ekakeiyeklkgkfrvhiddrdirpgrkfndweikgvplrievgpkdienkkitlfrrdt
mekfqvdetqlmevvektlnnimeniknrawekfenfitiledinpdeiknilsekrgvi
lvpfkeeiyneeleekveatilgeteykgnkyiaiakty
Download sequence
Identical sequences 1nj8_A 1nj8_B 1nj8_C 1nj8_D 1nj8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]