SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nkuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nkuA
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.85e-130
Family 3-Methyladenine DNA glycosylase I (Tag) 0.000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nkuA   PDB: 1nku   SUPERFAMILY: 1nkuA
Sequence length 187
Comment (A:)
Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACF
HQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFV
NHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC
CYPGNKP
Download sequence
Identical sequences A0A140N4M6 A0A142H854 A0A1V3VWH1
gi|254163472|ref|YP_003046580.1| gi|251786793|ref|YP_003001097.1| WP_000438944.1.12060 WP_000438944.1.12675 WP_000438944.1.13002 WP_000438944.1.17360 WP_000438944.1.18588 WP_000438944.1.20170 WP_000438944.1.21017 WP_000438944.1.24316 WP_000438944.1.25312 WP_000438944.1.27611 WP_000438944.1.31506 WP_000438944.1.35704 WP_000438944.1.36739 WP_000438944.1.39167 WP_000438944.1.41960 WP_000438944.1.46573 WP_000438944.1.47764 WP_000438944.1.48847 WP_000438944.1.51380 WP_000438944.1.51548 WP_000438944.1.52421 WP_000438944.1.54476 WP_000438944.1.56197 WP_000438944.1.56285 WP_000438944.1.59912 WP_000438944.1.66280 WP_000438944.1.67200 WP_000438944.1.6945 WP_000438944.1.71632 WP_000438944.1.76948 WP_000438944.1.79306 WP_000438944.1.81576 WP_000438944.1.8345 WP_000438944.1.84877 WP_000438944.1.88711 WP_000438944.1.89977 WP_000438944.1.93971 413997.ECB_03399 469008.ECBD_0188 gi|251786793|ref|YP_003001097.1| 000003028|e1nkuA1|102.1.2.1|A:1-187 000048295|e1lmzA1|102.1.2.1|A:1-187 000048296|e1p7mA1|102.1.2.1|A:1-187 cath|current|1lmzA00/1-187 cath|current|1nkuA00/1-187 cath|current|1p7mA00/1-187 d1lmza_ d1nkua_ d1p7ma_ 1lmz_A 1nku_A 1p7m_A 1nkuA gi|253771618|ref|YP_003034449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]