SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nkwY from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nkwY
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 1.05e-20
Family Ribosomal protein L31p 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nkwY   PDB: 1nkw   SUPERFAMILY: 1nkwY
Sequence length 73
Comment (Y:)
Sequence
MQKDLHPKAVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGRVDKFN
KRFGDSYRRGSKK
Download sequence
Identical sequences Q9RW44
243230.DR_0825 000155526|e1vor11|4987.1.1.2|1:1-73 000268915|e1sm1Y1|4987.1.1.2|Y:1-73 000274066|e1vou11|4987.1.1.2|1:1-73 000274123|e1vow11|4987.1.1.2|1:1-73 000274180|e1voy11|4987.1.1.2|1:1-73 000274237|e1vp011|4987.1.1.2|1:1-73 000279318|e1xbpY1|4987.1.1.2|Y:1-73 000280951|e1yl341|4987.1.1.2|4:1-73 000293265|e2b6641|4987.1.1.2|4:1-73 000293322|e2b9n41|4987.1.1.2|4:1-73 000293373|e2b9p41|4987.1.1.2|4:1-73 000439340|e1nwxY1|4987.1.1.2|Y:1-73 000439369|e1nwyY1|4987.1.1.2|Y:1-73 000440667|e1pnuY1|4987.1.1.2|Y:1-73 000440721|e1pnyY1|4987.1.1.2|Y:1-73 000481442|e1nkwY1|4987.1.1.2|Y:1-73 001428541|e4v49BY1|4987.1.1.2|BY:1-73 001428598|e4v4aBY1|4987.1.1.2|BY:1-73 001429135|e4v4gB11|4987.1.1.2|B1:1-73 001429136|e4v4gD11|4987.1.1.2|D1:1-73 001429137|e4v4gF11|4987.1.1.2|F1:1-73 001429138|e4v4gH11|4987.1.1.2|H1:1-73 001429139|e4v4gJ11|4987.1.1.2|J1:1-73 001429734|e4v4pA41|4987.1.1.2|A4:1-73 001429924|e4v4rB41|4987.1.1.2|B4:1-73 001429982|e4v4sB41|4987.1.1.2|B4:1-73 001430036|e4v4tB41|4987.1.1.2|B4:1-73 gi|15805851|ref|NP_294549.1| 1nkwY NP_294549.1.55610 WP_010887471.1.45201 WP_010887471.1.61927 WP_010887471.1.72503 WP_010887471.1.73314 WP_010887471.1.86829 1nkw_Y 1nwx_Y 1nwy_Y 1sm1_Y 1xbp_Y 4v49_BY 4v4a_BY 4v4g_B1 4v4g_D1 4v4g_F1 4v4g_H1 4v4g_J1 4v4p_A4 4v4r_B4 4v4s_B4 4v4t_B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]