SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nnhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nnhA
Domain Number 1 Region: 7-290
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.8e-57
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nnhA   PDB: 1nnh   SUPERFAMILY: 1nnhA
Sequence length 294
Comment (A:)
Sequence
MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEP
AEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDDGRHAYEFTQLDFE
VERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEM
EEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNE
DSFRPYLEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI
Download sequence
Identical sequences I6V115 Q8TZN6
WP_011013093.1.13913 WP_011013093.1.59273 1nnhA gi|18978323|ref|NP_579680.1| 186497.PF1951 cath|current|1nnhA00/2-294 Pfu-1801964-001 1nnh_A gi|397652401|ref|YP_006492982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]