SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1npoC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1npoC
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Neurophysin II 3.22e-37
Family Neurophysin II 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1npoC   PDB: 1npo   SUPERFAMILY: 1npoC
Sequence length 95
Comment (C:)
Sequence
amsdlelrqclpcgpggagrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccndescvtepecregvgfprrv
Download sequence
Identical sequences cath|current|1npoC00/7-85 1npoC 1npo_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]