SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nt4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nt4A
Domain Number 1 Region: 2-389
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.35e-75
Family Histidine acid phosphatase 0.0000000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nt4A   PDB: 1nt4   SUPERFAMILY: 1nt4A
Sequence length 391
Comment (A:)
Sequence
qtvpegyqlqqvlmmsranlraplanngsvleqstpnkwpewdvpggqlttkggvlevym
ghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhhqekm
gtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqc
slvdgkntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvl
sklkngyqdslftspevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltal
dfkpyqlhdqnertpiggkivfqrwhdskanrdlmkieyvyqsaeqlrnadaltlqapaq
rvtlelsgcpidadgfcpmdkfdsvlneavk
Download sequence
Identical sequences 1nt4A 000010478|e1nt4A1|2111.21.1.2|A:1-391 000108943|e1nt4B1|2111.21.1.2|B:1-391 d1nt4a_ d1nt4b_ 1nt4_A 1nt4_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]