SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nwbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nwbA
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily HesB-like domain 3.07e-59
Family HesB-like domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nwbA   PDB: 1nwb   SUPERFAMILY: 1nwbA
Sequence length 124
Comment (A:)
Sequence
mqeqaqqfifkvtdkaveeikkvaqennienpilrirvvpggcsgfqyamgfddtveegd
hvfeydgvkvvidpfsmpyvngaeldyvvdfmgggftirnpnatgscgcgssfscglehh
hhhh
Download sequence
Identical sequences 1nwb_A 1nwbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]