SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nyhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nyhA
Domain Number 1 Region: 80-154
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 3.07e-44
Family Dimerization motif of sir4 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nyhA   PDB: 1nyh   SUPERFAMILY: 1nyhA
Sequence length 166
Comment (A:)
Sequence
gplgskrvpivedrrvkqldditdsntteiltsvdvlgthsqtgtqqsnmytstqktele
idnkdsvtecskdmkedglsfvdivlskaasaldekekqlavaneiirslsdevmrneir
itslqgdltftkkclenarsqisekdakinklmekdfqvnkeikpy
Download sequence
Identical sequences 1nyhA 1nyh_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]