SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1nyrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1nyrA
Domain Number 1 Region: 241-537
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.72e-204
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 54-244
Classification Level Classification E-value
Superfamily ECOD 1.2e-120
Family ECOD 0.0034
Further Details:      
 
Domain Number 3 Region: 73-199
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.17e-68
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000000391
Further Details:      
 
Domain Number 4 Region: 539-632
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.33e-54
Family Anticodon-binding domain of Class II aaRS 0.0000195
Further Details:      
 
Domain Number 5 Region: 4-63
Classification Level Classification E-value
Superfamily TGS-like 2.93e-16
Family TGS domain 0.0000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1nyrA   PDB: 1nyr
Sequence length 645
Comment (A:)
Sequence
MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIE
IVTPGSEEALEVLRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFE
QIEKTMKQIVNENMKIERKVVSRDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDL
CRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNKMLQRIYGTAFFDKKELKAHLQMLEERKE
RDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLAN
VDLYKTSGHWDHYQEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAEL
GTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSF
RLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAM
GKEETLSTAQLDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFP
TWLAPKQVQIIPVNVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQ
IVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKKHR
Download sequence
Identical sequences A0A0E1AL29 A0A0E1VGQ6 A0A0E1X6Z2 A0A1E8WU02 A0A2K1AE28 A5ITK7 A6QHL6 A6U2F0 A8Z2J8 Q2FG54 Q5HF90 Q6G8P3 Q6GG23 Q8NW68 T1Y9N7 W8TVM8
gi|545638011|ref|YP_008588187.1| gi|87161367|ref|YP_494324.1| gi|150394230|ref|YP_001316905.1| jgi|Aspzo1|152524|fgenesh1_pm.9_#_16 1nyrA gi|470199379|ref|YP_007585779.1| gi|470224936|ref|YP_007623515.1| gi|384862280|ref|YP_005745000.1| gi|385781958|ref|YP_005758129.1| gi|379021459|ref|YP_005298121.1| gi|532359763|ref|YP_008449592.1| gi|470195446|ref|YP_007581798.1| gi|49486509|ref|YP_043730.1| gi|537442981|ref|YP_008485558.1| 1nyq_A 1nyq_B 1nyr_A 1nyr_B gi|521212486|ref|YP_008168832.1| gi|479329689|ref|YP_007868748.1| gi|545635152|ref|YP_008585722.1| gi|514066613|ref|YP_008128533.1| WP_000435132.1.100013 WP_000435132.1.100041 WP_000435132.1.100049 WP_000435132.1.100057 WP_000435132.1.100072 WP_000435132.1.100075 WP_000435132.1.100088 WP_000435132.1.100090 WP_000435132.1.100094 WP_000435132.1.100096 WP_000435132.1.10014 WP_000435132.1.100154 WP_000435132.1.100171 WP_000435132.1.100180 WP_000435132.1.100184 WP_000435132.1.100189 WP_000435132.1.100235 WP_000435132.1.100298 WP_000435132.1.100307 WP_000435132.1.10032 WP_000435132.1.100335 WP_000435132.1.100352 WP_000435132.1.100357 WP_000435132.1.100366 WP_000435132.1.100384 WP_000435132.1.100391 WP_000435132.1.100399 WP_000435132.1.10041 WP_000435132.1.10046 WP_000435132.1.100464 WP_000435132.1.10050 WP_000435132.1.100507 WP_000435132.1.100527 WP_000435132.1.100535 WP_000435132.1.100551 WP_000435132.1.100560 WP_000435132.1.100562 WP_000435132.1.100582 WP_000435132.1.100596 WP_000435132.1.100604 WP_000435132.1.100612 WP_000435132.1.100613 WP_000435132.1.100631 WP_000435132.1.100647 WP_000435132.1.100665 WP_000435132.1.100668 WP_000435132.1.100693 WP_000435132.1.100699 WP_000435132.1.100704 WP_000435132.1.100719 WP_000435132.1.100768 WP_000435132.1.100785 WP_000435132.1.100823 WP_000435132.1.100832 WP_000435132.1.100834 WP_000435132.1.100860 WP_000435132.1.100888 WP_000435132.1.100903 WP_000435132.1.100920 WP_000435132.1.100934 WP_000435132.1.100956 WP_000435132.1.100963 WP_000435132.1.10097 WP_000435132.1.100981 WP_000435132.1.100986 WP_000435132.1.100987 WP_000435132.1.101002 WP_000435132.1.101017 WP_000435132.1.101019 WP_000435132.1.101023 WP_000435132.1.101027 WP_000435132.1.101068 WP_000435132.1.101071 WP_000435132.1.101072 WP_000435132.1.101084 WP_000435132.1.101103 WP_000435132.1.10111 WP_000435132.1.101160 WP_000435132.1.101177 WP_000435132.1.101192 WP_000435132.1.101240 WP_000435132.1.101262 WP_000435132.1.101266 WP_000435132.1.101298 WP_000435132.1.101327 WP_000435132.1.101330 WP_000435132.1.101355 WP_000435132.1.101375 WP_000435132.1.101379 WP_000435132.1.101393 WP_000435132.1.101402 WP_000435132.1.101406 WP_000435132.1.101414 WP_000435132.1.101440 WP_000435132.1.101441 WP_000435132.1.101458 WP_000435132.1.10148 WP_000435132.1.101490 WP_000435132.1.1015 WP_000435132.1.101505 WP_000435132.1.101511 WP_000435132.1.101566 WP_000435132.1.101567 WP_000435132.1.101570 WP_000435132.1.101598 WP_000435132.1.101615 WP_000435132.1.101617 WP_000435132.1.101619 WP_000435132.1.101627 WP_000435132.1.101645 WP_000435132.1.10165 WP_000435132.1.101657 WP_000435132.1.10166 WP_000435132.1.101661 WP_000435132.1.101691 WP_000435132.1.101704 WP_000435132.1.101716 WP_000435132.1.101725 WP_000435132.1.101728 WP_000435132.1.101731 WP_000435132.1.101745 WP_000435132.1.101758 WP_000435132.1.101775 WP_000435132.1.101778 WP_000435132.1.101779 WP_000435132.1.101788 WP_000435132.1.101813 WP_000435132.1.101820 WP_000435132.1.101824 WP_000435132.1.101825 WP_000435132.1.101831 WP_000435132.1.101852 WP_000435132.1.101902 WP_000435132.1.101906 WP_000435132.1.101921 WP_000435132.1.101922 WP_000435132.1.101943 WP_000435132.1.101950 WP_000435132.1.102065 WP_000435132.1.102066 WP_000435132.1.102070 WP_000435132.1.102096 WP_000435132.1.102123 WP_000435132.1.102130 WP_000435132.1.10214 WP_000435132.1.1022 WP_000435132.1.10232 WP_000435132.1.10238 WP_000435132.1.10240 WP_000435132.1.10244 WP_000435132.1.10249 WP_000435132.1.1025 WP_000435132.1.10274 WP_000435132.1.10292 WP_000435132.1.10294 WP_000435132.1.10301 WP_000435132.1.10306 WP_000435132.1.1031 WP_000435132.1.10321 WP_000435132.1.10343 WP_000435132.1.10355 WP_000435132.1.10397 WP_000435132.1.10408 WP_000435132.1.1043 WP_000435132.1.10431 WP_000435132.1.10436 WP_000435132.1.10450 WP_000435132.1.10478 WP_000435132.1.10481 WP_000435132.1.10486 WP_000435132.1.10503 WP_000435132.1.1052 WP_000435132.1.10542 WP_000435132.1.10565 WP_000435132.1.10583 WP_000435132.1.10614 WP_000435132.1.10624 WP_000435132.1.10644 WP_000435132.1.10664 WP_000435132.1.10679 WP_000435132.1.10707 WP_000435132.1.10726 WP_000435132.1.10742 WP_000435132.1.10749 WP_000435132.1.10751 WP_000435132.1.1077 WP_000435132.1.10823 WP_000435132.1.10841 WP_000435132.1.10858 WP_000435132.1.1087 WP_000435132.1.10917 WP_000435132.1.10919 WP_000435132.1.10928 WP_000435132.1.10942 WP_000435132.1.10950 WP_000435132.1.10965 WP_000435132.1.10969 WP_000435132.1.10976 WP_000435132.1.10979 WP_000435132.1.10986 WP_000435132.1.11001 WP_000435132.1.11069 WP_000435132.1.11073 WP_000435132.1.11074 WP_000435132.1.11076 WP_000435132.1.11083 WP_000435132.1.11084 WP_000435132.1.11129 WP_000435132.1.1115 WP_000435132.1.11162 WP_000435132.1.1120 WP_000435132.1.11202 WP_000435132.1.11220 WP_000435132.1.11228 WP_000435132.1.11234 WP_000435132.1.11261 WP_000435132.1.11282 WP_000435132.1.11286 WP_000435132.1.11287 WP_000435132.1.11294 WP_000435132.1.11312 WP_000435132.1.11322 WP_000435132.1.11333 WP_000435132.1.11348 WP_000435132.1.11353 WP_000435132.1.1136 WP_000435132.1.11365 WP_000435132.1.11378 WP_000435132.1.11391 WP_000435132.1.11403 WP_000435132.1.11407 WP_000435132.1.11434 WP_000435132.1.11441 WP_000435132.1.11447 WP_000435132.1.11463 WP_000435132.1.1147 WP_000435132.1.11488 WP_000435132.1.11492 WP_000435132.1.11494 WP_000435132.1.11504 WP_000435132.1.1151 WP_000435132.1.11513 WP_000435132.1.1152 WP_000435132.1.11525 WP_000435132.1.11540 WP_000435132.1.11556 WP_000435132.1.11558 WP_000435132.1.11571 WP_000435132.1.11592 WP_000435132.1.11611 WP_000435132.1.11640 WP_000435132.1.11646 WP_000435132.1.11663 WP_000435132.1.11665 WP_000435132.1.11692 WP_000435132.1.117 WP_000435132.1.1171 WP_000435132.1.11719 WP_000435132.1.11720 WP_000435132.1.11723 WP_000435132.1.11730 WP_000435132.1.11736 WP_000435132.1.11768 WP_000435132.1.11794 WP_000435132.1.11795 WP_000435132.1.11816 WP_000435132.1.11829 WP_000435132.1.11837 WP_000435132.1.11884 WP_000435132.1.11903 WP_000435132.1.11904 WP_000435132.1.11969 WP_000435132.1.11991 WP_000435132.1.12019 WP_000435132.1.12026 WP_000435132.1.12029 WP_000435132.1.12042 WP_000435132.1.1205 WP_000435132.1.12073 WP_000435132.1.1210 WP_000435132.1.12123 WP_000435132.1.1213 WP_000435132.1.12149 WP_000435132.1.12152 WP_000435132.1.12158 WP_000435132.1.12170 WP_000435132.1.12175 WP_000435132.1.12179 WP_000435132.1.12193 WP_000435132.1.12201 WP_000435132.1.12226 WP_000435132.1.12233 WP_000435132.1.12234 WP_000435132.1.12256 WP_000435132.1.12272 WP_000435132.1.12297 WP_000435132.1.12328 WP_000435132.1.12330 WP_000435132.1.12437 WP_000435132.1.12447 WP_000435132.1.12498 WP_000435132.1.12508 WP_000435132.1.12516 WP_000435132.1.1252 WP_000435132.1.1253 WP_000435132.1.12555 WP_000435132.1.1257 WP_000435132.1.12598 WP_000435132.1.12608 WP_000435132.1.12618 WP_000435132.1.12639 WP_000435132.1.12685 WP_000435132.1.12711 WP_000435132.1.12715 WP_000435132.1.12733 WP_000435132.1.12737 WP_000435132.1.1276 WP_000435132.1.12770 WP_000435132.1.12771 WP_000435132.1.12772 WP_000435132.1.12780 WP_000435132.1.12788 WP_000435132.1.12822 WP_000435132.1.12829 WP_000435132.1.12833 WP_000435132.1.12845 WP_000435132.1.12858 WP_000435132.1.12862 WP_000435132.1.12884 WP_000435132.1.12886 WP_000435132.1.12903 WP_000435132.1.12904 WP_000435132.1.12918 WP_000435132.1.12920 WP_000435132.1.12937 WP_000435132.1.12938 WP_000435132.1.13013 WP_000435132.1.13039 WP_000435132.1.13062 WP_000435132.1.13072 WP_000435132.1.13091 WP_000435132.1.13104 WP_000435132.1.13164 WP_000435132.1.13169 WP_000435132.1.13189 WP_000435132.1.13243 WP_000435132.1.13250 WP_000435132.1.13307 WP_000435132.1.13322 WP_000435132.1.13326 WP_000435132.1.13336 WP_000435132.1.13355 WP_000435132.1.13379 WP_000435132.1.13405 WP_000435132.1.13448 WP_000435132.1.13468 WP_000435132.1.1347 WP_000435132.1.13486 WP_000435132.1.13501 WP_000435132.1.13505 WP_000435132.1.13514 WP_000435132.1.13531 WP_000435132.1.13532 WP_000435132.1.1355 WP_000435132.1.13554 WP_000435132.1.13556 WP_000435132.1.13557 WP_000435132.1.13568 WP_000435132.1.13612 WP_000435132.1.13617 WP_000435132.1.13650 WP_000435132.1.13654 WP_000435132.1.13665 WP_000435132.1.13668 WP_000435132.1.13670 WP_000435132.1.13683 WP_000435132.1.13696 WP_000435132.1.13709 WP_000435132.1.13726 WP_000435132.1.13727 WP_000435132.1.13733 WP_000435132.1.13734 WP_000435132.1.1374 WP_000435132.1.1375 WP_000435132.1.13755 WP_000435132.1.13757 WP_000435132.1.13772 WP_000435132.1.13804 WP_000435132.1.13805 WP_000435132.1.13807 WP_000435132.1.13831 WP_000435132.1.13879 WP_000435132.1.13897 WP_000435132.1.13904 WP_000435132.1.13914 WP_000435132.1.13933 WP_000435132.1.13940 WP_000435132.1.13986 WP_000435132.1.14025 WP_000435132.1.14034 WP_000435132.1.14071 WP_000435132.1.14097 WP_000435132.1.14112 WP_000435132.1.14143 WP_000435132.1.14153 WP_000435132.1.14163 WP_000435132.1.14192 WP_000435132.1.1420 WP_000435132.1.14201 WP_000435132.1.14221 WP_000435132.1.14233 WP_000435132.1.1425 WP_000435132.1.1426 WP_000435132.1.14272 WP_000435132.1.1429 WP_000435132.1.14302 WP_000435132.1.14305 WP_000435132.1.14314 WP_000435132.1.14342 WP_000435132.1.14355 WP_000435132.1.14358 WP_000435132.1.14364 WP_000435132.1.14365 WP_000435132.1.14366 WP_000435132.1.14372 WP_000435132.1.14394 WP_000435132.1.14397 WP_000435132.1.14412 WP_000435132.1.14418 WP_000435132.1.14475 WP_000435132.1.14535 WP_000435132.1.1457 WP_000435132.1.14577 WP_000435132.1.14590 WP_000435132.1.14596 WP_000435132.1.14639 WP_000435132.1.14696 WP_000435132.1.147 WP_000435132.1.1471 WP_000435132.1.14729 WP_000435132.1.14734 WP_000435132.1.14744 WP_000435132.1.1477 WP_000435132.1.14774 WP_000435132.1.14782 WP_000435132.1.14787 WP_000435132.1.14809 WP_000435132.1.14823 WP_000435132.1.14825 WP_000435132.1.14846 WP_000435132.1.14866 WP_000435132.1.14868 WP_000435132.1.14869 WP_000435132.1.14874 WP_000435132.1.14888 WP_000435132.1.1490 WP_000435132.1.14924 WP_000435132.1.14967 WP_000435132.1.14970 WP_000435132.1.14987 WP_000435132.1.15015 WP_000435132.1.15022 WP_000435132.1.15029 WP_000435132.1.15039 WP_000435132.1.15091 WP_000435132.1.15098 WP_000435132.1.15108 WP_000435132.1.15173 WP_000435132.1.15182 WP_000435132.1.15185 WP_000435132.1.1520 WP_000435132.1.15228 WP_000435132.1.15234 WP_000435132.1.15241 WP_000435132.1.1525 WP_000435132.1.15263 WP_000435132.1.15268 WP_000435132.1.15269 WP_000435132.1.15278 WP_000435132.1.15294 WP_000435132.1.15296 WP_000435132.1.15389 WP_000435132.1.15399 WP_000435132.1.15409 WP_000435132.1.15421 WP_000435132.1.15438 WP_000435132.1.1545 WP_000435132.1.15478 WP_000435132.1.15489 WP_000435132.1.15505 WP_000435132.1.15507 WP_000435132.1.15519 WP_000435132.1.15524 WP_000435132.1.15533 WP_000435132.1.15544 WP_000435132.1.15546 WP_000435132.1.15554 WP_000435132.1.15572 WP_000435132.1.1558 WP_000435132.1.15590 WP_000435132.1.15601 WP_000435132.1.1562 WP_000435132.1.1564 WP_000435132.1.15641 WP_000435132.1.15687 WP_000435132.1.15691 WP_000435132.1.15706 WP_000435132.1.15712 WP_000435132.1.15753 WP_000435132.1.15785 WP_000435132.1.15812 WP_000435132.1.15818 WP_000435132.1.1583 WP_000435132.1.15838 WP_000435132.1.15883 WP_000435132.1.15892 WP_000435132.1.15897 WP_000435132.1.15898 WP_000435132.1.159 WP_000435132.1.15920 WP_000435132.1.15921 WP_000435132.1.15925 WP_000435132.1.15928 WP_000435132.1.15957 WP_000435132.1.15972 WP_000435132.1.1599 WP_000435132.1.1600 WP_000435132.1.16018 WP_000435132.1.16026 WP_000435132.1.1606 WP_000435132.1.16068 WP_000435132.1.16083 WP_000435132.1.16095 WP_000435132.1.16096 WP_000435132.1.16098 WP_000435132.1.16112 WP_000435132.1.16114 WP_000435132.1.16140 WP_000435132.1.16173 WP_000435132.1.16195 WP_000435132.1.16203 WP_000435132.1.16213 WP_000435132.1.16214 WP_000435132.1.16223 WP_000435132.1.1623 WP_000435132.1.16237 WP_000435132.1.16251 WP_000435132.1.16265 WP_000435132.1.16276 WP_000435132.1.16283 WP_000435132.1.16311 WP_000435132.1.16362 WP_000435132.1.16372 WP_000435132.1.16395 WP_000435132.1.16407 WP_000435132.1.16408 WP_000435132.1.16414 WP_000435132.1.16417 WP_000435132.1.16433 WP_000435132.1.16455 WP_000435132.1.16458 WP_000435132.1.16467 WP_000435132.1.16554 WP_000435132.1.16564 WP_000435132.1.16569 WP_000435132.1.16589 WP_000435132.1.16603 WP_000435132.1.16606 WP_000435132.1.1662 WP_000435132.1.16628 WP_000435132.1.16632 WP_000435132.1.16639 WP_000435132.1.16649 WP_000435132.1.1665 WP_000435132.1.16651 WP_000435132.1.16653 WP_000435132.1.1666 WP_000435132.1.16664 WP_000435132.1.16672 WP_000435132.1.16679 WP_000435132.1.16684 WP_000435132.1.16693 WP_000435132.1.16703 WP_000435132.1.16757 WP_000435132.1.16761 WP_000435132.1.16762 WP_000435132.1.16768 WP_000435132.1.16770 WP_000435132.1.16776 WP_000435132.1.16794 WP_000435132.1.16802 WP_000435132.1.16824 WP_000435132.1.16833 WP_000435132.1.16880 WP_000435132.1.16882 WP_000435132.1.16892 WP_000435132.1.16920 WP_000435132.1.16936 WP_000435132.1.16938 WP_000435132.1.16969 WP_000435132.1.17038 WP_000435132.1.17046 WP_000435132.1.17050 WP_000435132.1.17080 WP_000435132.1.17104 WP_000435132.1.17122 WP_000435132.1.17132 WP_000435132.1.17137 WP_000435132.1.17139 WP_000435132.1.17157 WP_000435132.1.17169 WP_000435132.1.17180 WP_000435132.1.17193 WP_000435132.1.17200 WP_000435132.1.17231 WP_000435132.1.17234 WP_000435132.1.17240 WP_000435132.1.17248 WP_000435132.1.17249 WP_000435132.1.1725 WP_000435132.1.17256 WP_000435132.1.17289 WP_000435132.1.17296 WP_000435132.1.17309 WP_000435132.1.17320 WP_000435132.1.17327 WP_000435132.1.1736 WP_000435132.1.1740 WP_000435132.1.1741 WP_000435132.1.17419 WP_000435132.1.17450 WP_000435132.1.17454 WP_000435132.1.17475 WP_000435132.1.17485 WP_000435132.1.1751 WP_000435132.1.17520 WP_000435132.1.17524 WP_000435132.1.17526 WP_000435132.1.17529 WP_000435132.1.17531 WP_000435132.1.1756 WP_000435132.1.17581 WP_000435132.1.17590 WP_000435132.1.17628 WP_000435132.1.17643 WP_000435132.1.1765 WP_000435132.1.17650 WP_000435132.1.17651 WP_000435132.1.17658 WP_000435132.1.17666 WP_000435132.1.17671 WP_000435132.1.17676 WP_000435132.1.1771 WP_000435132.1.17717 WP_000435132.1.17718 WP_000435132.1.17720 WP_000435132.1.17725 WP_000435132.1.17729 WP_000435132.1.17737 WP_000435132.1.17770 WP_000435132.1.17796 WP_000435132.1.17818 WP_000435132.1.17832 WP_000435132.1.17834 WP_000435132.1.17835 WP_000435132.1.17838 WP_000435132.1.17845 WP_000435132.1.17847 WP_000435132.1.17853 WP_000435132.1.17859 WP_000435132.1.1787 WP_000435132.1.17876 WP_000435132.1.17882 WP_000435132.1.17909 WP_000435132.1.17922 WP_000435132.1.17929 WP_000435132.1.17943 WP_000435132.1.17951 WP_000435132.1.17966 WP_000435132.1.17987 WP_000435132.1.18011 WP_000435132.1.18016 WP_000435132.1.18035 WP_000435132.1.18069 WP_000435132.1.18074 WP_000435132.1.18080 WP_000435132.1.18105 WP_000435132.1.1811 WP_000435132.1.18113 WP_000435132.1.18132 WP_000435132.1.18140 WP_000435132.1.18153 WP_000435132.1.18197 WP_000435132.1.18203 WP_000435132.1.18237 WP_000435132.1.18248 WP_000435132.1.18273 WP_000435132.1.18283 WP_000435132.1.18288 WP_000435132.1.1829 WP_000435132.1.18290 WP_000435132.1.18301 WP_000435132.1.18309 WP_000435132.1.18310 WP_000435132.1.18320 WP_000435132.1.1835 WP_000435132.1.18360 WP_000435132.1.18412 WP_000435132.1.18429 WP_000435132.1.18437 WP_000435132.1.18451 WP_000435132.1.18466 WP_000435132.1.1847 WP_000435132.1.18487 WP_000435132.1.1849 WP_000435132.1.18497 WP_000435132.1.18504 WP_000435132.1.18506 WP_000435132.1.18507 WP_000435132.1.1851 WP_000435132.1.18516 WP_000435132.1.18526 WP_000435132.1.18527 WP_000435132.1.18529 WP_000435132.1.18538 WP_000435132.1.18545 WP_000435132.1.18560 WP_000435132.1.18562 WP_000435132.1.18566 WP_000435132.1.18567 WP_000435132.1.18570 WP_000435132.1.18591 WP_000435132.1.18605 WP_000435132.1.18611 WP_000435132.1.18627 WP_000435132.1.18632 WP_000435132.1.18668 WP_000435132.1.18679 WP_000435132.1.18758 WP_000435132.1.18763 WP_000435132.1.18774 WP_000435132.1.18777 WP_000435132.1.18779 WP_000435132.1.18792 WP_000435132.1.18799 WP_000435132.1.18809 WP_000435132.1.18818 WP_000435132.1.18819 WP_000435132.1.18830 WP_000435132.1.18834 WP_000435132.1.18836 WP_000435132.1.18870 WP_000435132.1.18879 WP_000435132.1.18882 WP_000435132.1.18918 WP_000435132.1.1892 WP_000435132.1.18938 WP_000435132.1.18968 WP_000435132.1.18974 WP_000435132.1.18987 WP_000435132.1.18996 WP_000435132.1.19009 WP_000435132.1.1901 WP_000435132.1.19022 WP_000435132.1.19027 WP_000435132.1.19052 WP_000435132.1.19082 WP_000435132.1.1911 WP_000435132.1.1912 WP_000435132.1.19149 WP_000435132.1.19179 WP_000435132.1.192 WP_000435132.1.19272 WP_000435132.1.19322 WP_000435132.1.19365 WP_000435132.1.19370 WP_000435132.1.19386 WP_000435132.1.19390 WP_000435132.1.19411 WP_000435132.1.19430 WP_000435132.1.19444 WP_000435132.1.19450 WP_000435132.1.19455 WP_000435132.1.19497 WP_000435132.1.19509 WP_000435132.1.19515 WP_000435132.1.19537 WP_000435132.1.19555 WP_000435132.1.19575 WP_000435132.1.19577 WP_000435132.1.1964 WP_000435132.1.19643 WP_000435132.1.19653 WP_000435132.1.19701 WP_000435132.1.19717 WP_000435132.1.19725 WP_000435132.1.19733 WP_000435132.1.1974 WP_000435132.1.19748 WP_000435132.1.1975 WP_000435132.1.19765 WP_000435132.1.19775 WP_000435132.1.19788 WP_000435132.1.19792 WP_000435132.1.19801 WP_000435132.1.19816 WP_000435132.1.19848 WP_000435132.1.19853 WP_000435132.1.19891 WP_000435132.1.19904 WP_000435132.1.19905 WP_000435132.1.19912 WP_000435132.1.19928 WP_000435132.1.19968 WP_000435132.1.19977 WP_000435132.1.19980 WP_000435132.1.19981 WP_000435132.1.19982 WP_000435132.1.2 WP_000435132.1.20006 WP_000435132.1.20049 WP_000435132.1.20052 WP_000435132.1.20057 WP_000435132.1.2007 WP_000435132.1.20078 WP_000435132.1.2008 WP_000435132.1.20090 WP_000435132.1.20100 WP_000435132.1.20101 WP_000435132.1.2013 WP_000435132.1.20155 WP_000435132.1.20156 WP_000435132.1.20160 WP_000435132.1.20161 WP_000435132.1.20167 WP_000435132.1.20177 WP_000435132.1.20191 WP_000435132.1.20201 WP_000435132.1.20214 WP_000435132.1.20219 WP_000435132.1.20221 WP_000435132.1.20235 WP_000435132.1.20245 WP_000435132.1.2025 WP_000435132.1.20265 WP_000435132.1.2029 WP_000435132.1.20307 WP_000435132.1.20324 WP_000435132.1.20340 WP_000435132.1.20386 WP_000435132.1.20394 WP_000435132.1.20398 WP_000435132.1.20399 WP_000435132.1.20411 WP_000435132.1.20447 WP_000435132.1.20473 WP_000435132.1.20479 WP_000435132.1.20487 WP_000435132.1.20496 WP_000435132.1.20500 WP_000435132.1.20512 WP_000435132.1.20550 WP_000435132.1.20554 WP_000435132.1.2056 WP_000435132.1.20574 WP_000435132.1.20579 WP_000435132.1.20585 WP_000435132.1.20598 WP_000435132.1.20611 WP_000435132.1.20618 WP_000435132.1.20619 WP_000435132.1.20620 WP_000435132.1.20649 WP_000435132.1.20690 WP_000435132.1.20736 WP_000435132.1.20772 WP_000435132.1.2079 WP_000435132.1.20796 WP_000435132.1.20821 WP_000435132.1.20833 WP_000435132.1.20838 WP_000435132.1.20860 WP_000435132.1.20866 WP_000435132.1.20867 WP_000435132.1.20878 WP_000435132.1.20906 WP_000435132.1.20913 WP_000435132.1.20922 WP_000435132.1.20939 WP_000435132.1.20945 WP_000435132.1.20971 WP_000435132.1.20975 WP_000435132.1.21009 WP_000435132.1.21013 WP_000435132.1.21015 WP_000435132.1.21036 WP_000435132.1.21054 WP_000435132.1.21056 WP_000435132.1.21066 WP_000435132.1.21078 WP_000435132.1.21081 WP_000435132.1.21109 WP_000435132.1.21111 WP_000435132.1.21140 WP_000435132.1.21154 WP_000435132.1.21183 WP_000435132.1.2119 WP_000435132.1.21222 WP_000435132.1.21257 WP_000435132.1.21259 WP_000435132.1.21272 WP_000435132.1.2128 WP_000435132.1.2129 WP_000435132.1.21312 WP_000435132.1.21313 WP_000435132.1.21314 WP_000435132.1.2135 WP_000435132.1.21356 WP_000435132.1.21359 WP_000435132.1.21375 WP_000435132.1.21386 WP_000435132.1.21393 WP_000435132.1.21402 WP_000435132.1.21412 WP_000435132.1.21416 WP_000435132.1.21449 WP_000435132.1.21458 WP_000435132.1.21464 WP_000435132.1.21465 WP_000435132.1.21480 WP_000435132.1.21500 WP_000435132.1.21505 WP_000435132.1.21514 WP_000435132.1.2154 WP_000435132.1.21572 WP_000435132.1.21583 WP_000435132.1.21589 WP_000435132.1.2159 WP_000435132.1.2160 WP_000435132.1.21601 WP_000435132.1.21621 WP_000435132.1.21636 WP_000435132.1.21679 WP_000435132.1.21712 WP_000435132.1.21719 WP_000435132.1.21724 WP_000435132.1.21746 WP_000435132.1.21763 WP_000435132.1.2178 WP_000435132.1.21787 WP_000435132.1.21820 WP_000435132.1.21830 WP_000435132.1.21890 WP_000435132.1.21900 WP_000435132.1.21901 WP_000435132.1.21919 WP_000435132.1.21985 WP_000435132.1.21988 WP_000435132.1.2200 WP_000435132.1.22000 WP_000435132.1.22011 WP_000435132.1.22027 WP_000435132.1.22033 WP_000435132.1.22038 WP_000435132.1.22049 WP_000435132.1.22065 WP_000435132.1.22082 WP_000435132.1.22111 WP_000435132.1.22149 WP_000435132.1.22163 WP_000435132.1.22164 WP_000435132.1.22165 WP_000435132.1.22170 WP_000435132.1.22174 WP_000435132.1.22177 WP_000435132.1.22180 WP_000435132.1.22197 WP_000435132.1.22227 WP_000435132.1.22246 WP_000435132.1.22302 WP_000435132.1.22332 WP_000435132.1.22344 WP_000435132.1.22351 WP_000435132.1.22367 WP_000435132.1.22400 WP_000435132.1.22419 WP_000435132.1.22426 WP_000435132.1.22441 WP_000435132.1.22493 WP_000435132.1.22498 WP_000435132.1.22512 WP_000435132.1.22526 WP_000435132.1.22533 WP_000435132.1.22547 WP_000435132.1.22551 WP_000435132.1.22559 WP_000435132.1.22650 WP_000435132.1.22657 WP_000435132.1.22684 WP_000435132.1.22696 WP_000435132.1.22702 WP_000435132.1.22709 WP_000435132.1.22731 WP_000435132.1.22738 WP_000435132.1.22764 WP_000435132.1.22787 WP_000435132.1.22789 WP_000435132.1.22790 WP_000435132.1.22792 WP_000435132.1.2280 WP_000435132.1.22803 WP_000435132.1.22808 WP_000435132.1.22811 WP_000435132.1.22826 WP_000435132.1.22843 WP_000435132.1.22853 WP_000435132.1.22859 WP_000435132.1.22861 WP_000435132.1.22869 WP_000435132.1.22890 WP_000435132.1.22924 WP_000435132.1.22969 WP_000435132.1.22983 WP_000435132.1.22984 WP_000435132.1.22994 WP_000435132.1.23004 WP_000435132.1.23008 WP_000435132.1.23012 WP_000435132.1.23061 WP_000435132.1.23082 WP_000435132.1.23103 WP_000435132.1.23121 WP_000435132.1.23130 WP_000435132.1.23132 WP_000435132.1.23133 WP_000435132.1.23146 WP_000435132.1.23152 WP_000435132.1.23161 WP_000435132.1.23185 WP_000435132.1.23197 WP_000435132.1.23228 WP_000435132.1.23238 WP_000435132.1.23244 WP_000435132.1.23251 WP_000435132.1.2327 WP_000435132.1.23275 WP_000435132.1.23288 WP_000435132.1.23304 WP_000435132.1.23381 WP_000435132.1.23413 WP_000435132.1.23420 WP_000435132.1.23431 WP_000435132.1.23439 WP_000435132.1.23449 WP_000435132.1.23450 WP_000435132.1.23476 WP_000435132.1.23489 WP_000435132.1.23491 WP_000435132.1.23517 WP_000435132.1.23531 WP_000435132.1.23541 WP_000435132.1.23544 WP_000435132.1.23557 WP_000435132.1.23572 WP_000435132.1.23580 WP_000435132.1.23586 WP_000435132.1.23613 WP_000435132.1.23626 WP_000435132.1.23630 WP_000435132.1.23644 WP_000435132.1.2365 WP_000435132.1.23671 WP_000435132.1.23690 WP_000435132.1.23708 WP_000435132.1.23710 WP_000435132.1.23730 WP_000435132.1.23740 WP_000435132.1.23796 WP_000435132.1.23809 WP_000435132.1.23822 WP_000435132.1.23842 WP_000435132.1.23849 WP_000435132.1.2389 WP_000435132.1.23900 WP_000435132.1.23902 WP_000435132.1.23907 WP_000435132.1.23926 WP_000435132.1.23935 WP_000435132.1.23944 WP_000435132.1.23956 WP_000435132.1.23972 WP_000435132.1.23995 WP_000435132.1.23998 WP_000435132.1.24000 WP_000435132.1.24081 WP_000435132.1.24129 WP_000435132.1.24148 WP_000435132.1.24154 WP_000435132.1.24167 WP_000435132.1.24174 WP_000435132.1.24207 WP_000435132.1.24213 WP_000435132.1.24226 WP_000435132.1.2423 WP_000435132.1.24241 WP_000435132.1.24263 WP_000435132.1.2427 WP_000435132.1.24276 WP_000435132.1.24277 WP_000435132.1.24279 WP_000435132.1.24286 WP_000435132.1.24302 WP_000435132.1.2434 WP_000435132.1.24343 WP_000435132.1.24347 WP_000435132.1.24364 WP_000435132.1.24365 WP_000435132.1.24388 WP_000435132.1.24416 WP_000435132.1.24418 WP_000435132.1.2442 WP_000435132.1.24437 WP_000435132.1.24443 WP_000435132.1.24462 WP_000435132.1.24469 WP_000435132.1.24478 WP_000435132.1.2450 WP_000435132.1.24502 WP_000435132.1.24503 WP_000435132.1.24516 WP_000435132.1.24519 WP_000435132.1.24569 WP_000435132.1.24572 WP_000435132.1.2458 WP_000435132.1.24589 WP_000435132.1.24597 WP_000435132.1.24602 WP_000435132.1.24617 WP_000435132.1.24625 WP_000435132.1.24644 WP_000435132.1.24654 WP_000435132.1.24674 WP_000435132.1.24679 WP_000435132.1.24685 WP_000435132.1.24702 WP_000435132.1.24711 WP_000435132.1.24714 WP_000435132.1.24745 WP_000435132.1.24780 WP_000435132.1.24781 WP_000435132.1.2480 WP_000435132.1.24802 WP_000435132.1.24817 WP_000435132.1.24823 WP_000435132.1.24834 WP_000435132.1.24855 WP_000435132.1.24856 WP_000435132.1.24891 WP_000435132.1.24937 WP_000435132.1.2497 WP_000435132.1.24996 WP_000435132.1.25001 WP_000435132.1.25007 WP_000435132.1.2501 WP_000435132.1.25012 WP_000435132.1.2506 WP_000435132.1.25070 WP_000435132.1.25083 WP_000435132.1.25092 WP_000435132.1.25095 WP_000435132.1.25098 WP_000435132.1.25115 WP_000435132.1.25117 WP_000435132.1.25145 WP_000435132.1.25167 WP_000435132.1.25170 WP_000435132.1.25187 WP_000435132.1.25209 WP_000435132.1.25216 WP_000435132.1.25221 WP_000435132.1.25262 WP_000435132.1.25287 WP_000435132.1.25288 WP_000435132.1.25331 WP_000435132.1.25341 WP_000435132.1.25345 WP_000435132.1.25361 WP_000435132.1.25438 WP_000435132.1.25459 WP_000435132.1.25469 WP_000435132.1.25479 WP_000435132.1.25488 WP_000435132.1.25489 WP_000435132.1.25495 WP_000435132.1.25511 WP_000435132.1.25557 WP_000435132.1.25567 WP_000435132.1.25569 WP_000435132.1.25591 WP_000435132.1.25593 WP_000435132.1.25595 WP_000435132.1.25597 WP_000435132.1.25621 WP_000435132.1.25623 WP_000435132.1.25633 WP_000435132.1.25634 WP_000435132.1.25651 WP_000435132.1.25721 WP_000435132.1.25732 WP_000435132.1.25737 WP_000435132.1.25744 WP_000435132.1.25758 WP_000435132.1.25770 WP_000435132.1.25772 WP_000435132.1.25779 WP_000435132.1.2579 WP_000435132.1.25801 WP_000435132.1.25802 WP_000435132.1.25820 WP_000435132.1.25840 WP_000435132.1.25856 WP_000435132.1.25857 WP_000435132.1.25867 WP_000435132.1.25868 WP_000435132.1.25881 WP_000435132.1.25891 WP_000435132.1.2590 WP_000435132.1.25910 WP_000435132.1.2592 WP_000435132.1.25924 WP_000435132.1.25929 WP_000435132.1.2593 WP_000435132.1.25930 WP_000435132.1.25955 WP_000435132.1.26006 WP_000435132.1.26015 WP_000435132.1.26039 WP_000435132.1.26050 WP_000435132.1.26058 WP_000435132.1.2608 WP_000435132.1.26094 WP_000435132.1.26106 WP_000435132.1.26143 WP_000435132.1.26169 WP_000435132.1.262 WP_000435132.1.2621 WP_000435132.1.26225 WP_000435132.1.26255 WP_000435132.1.26266 WP_000435132.1.26271 WP_000435132.1.26276 WP_000435132.1.26283 WP_000435132.1.26290 WP_000435132.1.26293 WP_000435132.1.26298 WP_000435132.1.26307 WP_000435132.1.26314 WP_000435132.1.26315 WP_000435132.1.26318 WP_000435132.1.26340 WP_000435132.1.26345 WP_000435132.1.26346 WP_000435132.1.26354 WP_000435132.1.26359 WP_000435132.1.26364 WP_000435132.1.26370 WP_000435132.1.26399 WP_000435132.1.26404 WP_000435132.1.26424 WP_000435132.1.2643 WP_000435132.1.26431 WP_000435132.1.26481 WP_000435132.1.26506 WP_000435132.1.26533 WP_000435132.1.2656 WP_000435132.1.2658 WP_000435132.1.2661 WP_000435132.1.26626 WP_000435132.1.2664 WP_000435132.1.26650 WP_000435132.1.26662 WP_000435132.1.26663 WP_000435132.1.26664 WP_000435132.1.26677 WP_000435132.1.26692 WP_000435132.1.26726 WP_000435132.1.2673 WP_000435132.1.26733 WP_000435132.1.2674 WP_000435132.1.26751 WP_000435132.1.26771 WP_000435132.1.26772 WP_000435132.1.26773 WP_000435132.1.26778 WP_000435132.1.2680 WP_000435132.1.26804 WP_000435132.1.2684 WP_000435132.1.26840 WP_000435132.1.26864 WP_000435132.1.26865 WP_000435132.1.26884 WP_000435132.1.26886 WP_000435132.1.2689 WP_000435132.1.26903 WP_000435132.1.26905 WP_000435132.1.26927 WP_000435132.1.26938 WP_000435132.1.26944 WP_000435132.1.26947 WP_000435132.1.26958 WP_000435132.1.27013 WP_000435132.1.27042 WP_000435132.1.27053 WP_000435132.1.27083 WP_000435132.1.27097 WP_000435132.1.2710 WP_000435132.1.27120 WP_000435132.1.27127 WP_000435132.1.27147 WP_000435132.1.27154 WP_000435132.1.27160 WP_000435132.1.27166 WP_000435132.1.27170 WP_000435132.1.2718 WP_000435132.1.27182 WP_000435132.1.2719 WP_000435132.1.27226 WP_000435132.1.27246 WP_000435132.1.2725 WP_000435132.1.27262 WP_000435132.1.27293 WP_000435132.1.27303 WP_000435132.1.27323 WP_000435132.1.27333 WP_000435132.1.2734 WP_000435132.1.27345 WP_000435132.1.27379 WP_000435132.1.27384 WP_000435132.1.27387 WP_000435132.1.27413 WP_000435132.1.27415 WP_000435132.1.2744 WP_000435132.1.27447 WP_000435132.1.27448 WP_000435132.1.27455 WP_000435132.1.27456 WP_000435132.1.27457 WP_000435132.1.27468 WP_000435132.1.27489 WP_000435132.1.27516 WP_000435132.1.27529 WP_000435132.1.2753 WP_000435132.1.27539 WP_000435132.1.27551 WP_000435132.1.27562 WP_000435132.1.2759 WP_000435132.1.27590 WP_000435132.1.27605 WP_000435132.1.27608 WP_000435132.1.27614 WP_000435132.1.27615 WP_000435132.1.27621 WP_000435132.1.27622 WP_000435132.1.27628 WP_000435132.1.27646 WP_000435132.1.27654 WP_000435132.1.27662 WP_000435132.1.27667 WP_000435132.1.27670 WP_000435132.1.27673 WP_000435132.1.27689 WP_000435132.1.27717 WP_000435132.1.27720 WP_000435132.1.27739 WP_000435132.1.27744 WP_000435132.1.27748 WP_000435132.1.27765 WP_000435132.1.27793 WP_000435132.1.27817 WP_000435132.1.27830 WP_000435132.1.27834 WP_000435132.1.27854 WP_000435132.1.2795 WP_000435132.1.27950 WP_000435132.1.27953 WP_000435132.1.27999 WP_000435132.1.2800 WP_000435132.1.28007 WP_000435132.1.28016 WP_000435132.1.28025 WP_000435132.1.28063 WP_000435132.1.28071 WP_000435132.1.28074 WP_000435132.1.2808 WP_000435132.1.28088 WP_000435132.1.28091 WP_000435132.1.28105 WP_000435132.1.28107 WP_000435132.1.28117 WP_000435132.1.28138 WP_000435132.1.28147 WP_000435132.1.28158 WP_000435132.1.28173 WP_000435132.1.28191 WP_000435132.1.28226 WP_000435132.1.28253 WP_000435132.1.28257 WP_000435132.1.28274 WP_000435132.1.28298 WP_000435132.1.28315 WP_000435132.1.28319 WP_000435132.1.28336 WP_000435132.1.28337 WP_000435132.1.28347 WP_000435132.1.28358 WP_000435132.1.28360 WP_000435132.1.28376 WP_000435132.1.28381 WP_000435132.1.28388 WP_000435132.1.28392 WP_000435132.1.28394 WP_000435132.1.2840 WP_000435132.1.28430 WP_000435132.1.28477 WP_000435132.1.28490 WP_000435132.1.28498 WP_000435132.1.28501 WP_000435132.1.28502 WP_000435132.1.2852 WP_000435132.1.28526 WP_000435132.1.28527 WP_000435132.1.28532 WP_000435132.1.28578 WP_000435132.1.28580 WP_000435132.1.28605 WP_000435132.1.28629 WP_000435132.1.28636 WP_000435132.1.28650 WP_000435132.1.28652 WP_000435132.1.28710 WP_000435132.1.28720 WP_000435132.1.28725 WP_000435132.1.28763 WP_000435132.1.28784 WP_000435132.1.28785 WP_000435132.1.28825 WP_000435132.1.28833 WP_000435132.1.28848 WP_000435132.1.28862 WP_000435132.1.28866 WP_000435132.1.28871 WP_000435132.1.28874 WP_000435132.1.28887 WP_000435132.1.28909 WP_000435132.1.28915 WP_000435132.1.28933 WP_000435132.1.28934 WP_000435132.1.28960 WP_000435132.1.28970 WP_000435132.1.28981 WP_000435132.1.28987 WP_000435132.1.29014 WP_000435132.1.2906 WP_000435132.1.29060 WP_000435132.1.29090 WP_000435132.1.29091 WP_000435132.1.29107 WP_000435132.1.29110 WP_000435132.1.29112 WP_000435132.1.29155 WP_000435132.1.29166 WP_000435132.1.29170 WP_000435132.1.29187 WP_000435132.1.29188 WP_000435132.1.29207 WP_000435132.1.29226 WP_000435132.1.29242 WP_000435132.1.29250 WP_000435132.1.29263 WP_000435132.1.29272 WP_000435132.1.29276 WP_000435132.1.29282 WP_000435132.1.29285 WP_000435132.1.29312 WP_000435132.1.29315 WP_000435132.1.29329 WP_000435132.1.29340 WP_000435132.1.29368 WP_000435132.1.29372 WP_000435132.1.29373 WP_000435132.1.29375 WP_000435132.1.29381 WP_000435132.1.29395 WP_000435132.1.29420 WP_000435132.1.29433 WP_000435132.1.29453 WP_000435132.1.29468 WP_000435132.1.29479 WP_000435132.1.29483 WP_000435132.1.29484 WP_000435132.1.29511 WP_000435132.1.29522 WP_000435132.1.29541 WP_000435132.1.29554 WP_000435132.1.29561 WP_000435132.1.2957 WP_000435132.1.29571 WP_000435132.1.29596 WP_000435132.1.29644 WP_000435132.1.29676 WP_000435132.1.29692 WP_000435132.1.29709 WP_000435132.1.29716 WP_000435132.1.2972 WP_000435132.1.29736 WP_000435132.1.29744 WP_000435132.1.2975 WP_000435132.1.29758 WP_000435132.1.29781 WP_000435132.1.29788 WP_000435132.1.29805 WP_000435132.1.2981 WP_000435132.1.29826 WP_000435132.1.29862 WP_000435132.1.29885 WP_000435132.1.29902 WP_000435132.1.29905 WP_000435132.1.29918 WP_000435132.1.29956 WP_000435132.1.29963 WP_000435132.1.29981 WP_000435132.1.30012 WP_000435132.1.30033 WP_000435132.1.30047 WP_000435132.1.30051 WP_000435132.1.30057 WP_000435132.1.30089 WP_000435132.1.30095 WP_000435132.1.30100 WP_000435132.1.30115 WP_000435132.1.3012 WP_000435132.1.30150 WP_000435132.1.30152 WP_000435132.1.30154 WP_000435132.1.30159 WP_000435132.1.30169 WP_000435132.1.30176 WP_000435132.1.30188 WP_000435132.1.30190 WP_000435132.1.30197 WP_000435132.1.30203 WP_000435132.1.30204 WP_000435132.1.30209 WP_000435132.1.30230 WP_000435132.1.30249 WP_000435132.1.30262 WP_000435132.1.30268 WP_000435132.1.30274 WP_000435132.1.30294 WP_000435132.1.30302 WP_000435132.1.30307 WP_000435132.1.30328 WP_000435132.1.30333 WP_000435132.1.30350 WP_000435132.1.30364 WP_000435132.1.30367 WP_000435132.1.30376 WP_000435132.1.30392 WP_000435132.1.30418 WP_000435132.1.30422 WP_000435132.1.30458 WP_000435132.1.30477 WP_000435132.1.30482 WP_000435132.1.30496 WP_000435132.1.3050 WP_000435132.1.30508 WP_000435132.1.30530 WP_000435132.1.30531 WP_000435132.1.30600 WP_000435132.1.30622 WP_000435132.1.30623 WP_000435132.1.30645 WP_000435132.1.30646 WP_000435132.1.30666 WP_000435132.1.30668 WP_000435132.1.30690 WP_000435132.1.30702 WP_000435132.1.30720 WP_000435132.1.30726 WP_000435132.1.30758 WP_000435132.1.30763 WP_000435132.1.30768 WP_000435132.1.3077 WP_000435132.1.30779 WP_000435132.1.30845 WP_000435132.1.30847 WP_000435132.1.30861 WP_000435132.1.30862 WP_000435132.1.30863 WP_000435132.1.30874 WP_000435132.1.30878 WP_000435132.1.30889 WP_000435132.1.30911 WP_000435132.1.30916 WP_000435132.1.30945 WP_000435132.1.30962 WP_000435132.1.3097 WP_000435132.1.30970 WP_000435132.1.30971 WP_000435132.1.31005 WP_000435132.1.31022 WP_000435132.1.31037 WP_000435132.1.31039 WP_000435132.1.31048 WP_000435132.1.31091 WP_000435132.1.31114 WP_000435132.1.31123 WP_000435132.1.31124 WP_000435132.1.31176 WP_000435132.1.31194 WP_000435132.1.31204 WP_000435132.1.31206 WP_000435132.1.31212 WP_000435132.1.3123 WP_000435132.1.31232 WP_000435132.1.31294 WP_000435132.1.31315 WP_000435132.1.31337 WP_000435132.1.31339 WP_000435132.1.31355 WP_000435132.1.31363 WP_000435132.1.31376 WP_000435132.1.31402 WP_000435132.1.31424 WP_000435132.1.31426 WP_000435132.1.31437 WP_000435132.1.31442 WP_000435132.1.31468 WP_000435132.1.31478 WP_000435132.1.31479 WP_000435132.1.31484 WP_000435132.1.315 WP_000435132.1.31505 WP_000435132.1.31529 WP_000435132.1.31531 WP_000435132.1.31539 WP_000435132.1.31567 WP_000435132.1.31611 WP_000435132.1.31638 WP_000435132.1.31642 WP_000435132.1.31647 WP_000435132.1.31653 WP_000435132.1.31667 WP_000435132.1.31686 WP_000435132.1.31753 WP_000435132.1.31787 WP_000435132.1.31791 WP_000435132.1.31797 WP_000435132.1.31806 WP_000435132.1.31817 WP_000435132.1.31827 WP_000435132.1.31828 WP_000435132.1.31842 WP_000435132.1.31892 WP_000435132.1.31897 WP_000435132.1.31925 WP_000435132.1.31931 WP_000435132.1.31990 WP_000435132.1.31994 WP_000435132.1.31997 WP_000435132.1.32003 WP_000435132.1.32005 WP_000435132.1.32029 WP_000435132.1.32059 WP_000435132.1.32067 WP_000435132.1.32095 WP_000435132.1.32106 WP_000435132.1.32122 WP_000435132.1.32125 WP_000435132.1.32130 WP_000435132.1.32160 WP_000435132.1.32167 WP_000435132.1.3219 WP_000435132.1.32207 WP_000435132.1.32217 WP_000435132.1.32244 WP_000435132.1.32248 WP_000435132.1.32269 WP_000435132.1.32270 WP_000435132.1.32281 WP_000435132.1.3229 WP_000435132.1.32295 WP_000435132.1.32301 WP_000435132.1.32325 WP_000435132.1.32338 WP_000435132.1.32339 WP_000435132.1.32340 WP_000435132.1.32365 WP_000435132.1.32384 WP_000435132.1.32405 WP_000435132.1.3242 WP_000435132.1.3244 WP_000435132.1.32464 WP_000435132.1.32474 WP_000435132.1.32481 WP_000435132.1.32483 WP_000435132.1.32514 WP_000435132.1.32517 WP_000435132.1.32534 WP_000435132.1.32546 WP_000435132.1.32555 WP_000435132.1.32565 WP_000435132.1.32584 WP_000435132.1.32588 WP_000435132.1.32607 WP_000435132.1.32634 WP_000435132.1.32636 WP_000435132.1.32645 WP_000435132.1.32671 WP_000435132.1.32739 WP_000435132.1.32746 WP_000435132.1.32754 WP_000435132.1.32764 WP_000435132.1.32770 WP_000435132.1.32795 WP_000435132.1.328 WP_000435132.1.32800 WP_000435132.1.32839 WP_000435132.1.32898 WP_000435132.1.32921 WP_000435132.1.32925 WP_000435132.1.32928 WP_000435132.1.32939 WP_000435132.1.32954 WP_000435132.1.32965 WP_000435132.1.32980 WP_000435132.1.32987 WP_000435132.1.3299 WP_000435132.1.3301 WP_000435132.1.33038 WP_000435132.1.33048 WP_000435132.1.3306 WP_000435132.1.33108 WP_000435132.1.33110 WP_000435132.1.33123 WP_000435132.1.33138 WP_000435132.1.33147 WP_000435132.1.33161 WP_000435132.1.33172 WP_000435132.1.33199 WP_000435132.1.33212 WP_000435132.1.33213 WP_000435132.1.33250 WP_000435132.1.33252 WP_000435132.1.33255 WP_000435132.1.33266 WP_000435132.1.33277 WP_000435132.1.33296 WP_000435132.1.33307 WP_000435132.1.33335 WP_000435132.1.3335 WP_000435132.1.33350 WP_000435132.1.33357 WP_000435132.1.33368 WP_000435132.1.33372 WP_000435132.1.3338 WP_000435132.1.33388 WP_000435132.1.33394 WP_000435132.1.3341 WP_000435132.1.33416 WP_000435132.1.3342 WP_000435132.1.33426 WP_000435132.1.33432 WP_000435132.1.3345 WP_000435132.1.33463 WP_000435132.1.33468 WP_000435132.1.3347 WP_000435132.1.33483 WP_000435132.1.33507 WP_000435132.1.33516 WP_000435132.1.33518 WP_000435132.1.33520 WP_000435132.1.33540 WP_000435132.1.3357 WP_000435132.1.33575 WP_000435132.1.3358 WP_000435132.1.33626 WP_000435132.1.33627 WP_000435132.1.3363 WP_000435132.1.33650 WP_000435132.1.33654 WP_000435132.1.33692 WP_000435132.1.33695 WP_000435132.1.33718 WP_000435132.1.33720 WP_000435132.1.33724 WP_000435132.1.33737 WP_000435132.1.33743 WP_000435132.1.33765 WP_000435132.1.33778 WP_000435132.1.33792 WP_000435132.1.33804 WP_000435132.1.33813 WP_000435132.1.33816 WP_000435132.1.33855 WP_000435132.1.33899 WP_000435132.1.33915 WP_000435132.1.33963 WP_000435132.1.33966 WP_000435132.1.33968 WP_000435132.1.33971 WP_000435132.1.33983 WP_000435132.1.33994 WP_000435132.1.34026 WP_000435132.1.34030 WP_000435132.1.34051 WP_000435132.1.34062 WP_000435132.1.34069 WP_000435132.1.34079 WP_000435132.1.34080 WP_000435132.1.34100 WP_000435132.1.34105 WP_000435132.1.34112 WP_000435132.1.34128 WP_000435132.1.34132 WP_000435132.1.34168 WP_000435132.1.34172 WP_000435132.1.3418 WP_000435132.1.34182 WP_000435132.1.34194 WP_000435132.1.34209 WP_000435132.1.3422 WP_000435132.1.34223 WP_000435132.1.34231 WP_000435132.1.34244 WP_000435132.1.34250 WP_000435132.1.34251 WP_000435132.1.34280 WP_000435132.1.34285 WP_000435132.1.34307 WP_000435132.1.34334 WP_000435132.1.34361 WP_000435132.1.34381 WP_000435132.1.34403 WP_000435132.1.34410 WP_000435132.1.3442 WP_000435132.1.34438 WP_000435132.1.34471 WP_000435132.1.34482 WP_000435132.1.34492 WP_000435132.1.34502 WP_000435132.1.34510 WP_000435132.1.34512 WP_000435132.1.34526 WP_000435132.1.34531 WP_000435132.1.34569 WP_000435132.1.34578 WP_000435132.1.3461 WP_000435132.1.34620 WP_000435132.1.34626 WP_000435132.1.34666 WP_000435132.1.34677 WP_000435132.1.34716 WP_000435132.1.34737 WP_000435132.1.3474 WP_000435132.1.34741 WP_000435132.1.34767 WP_000435132.1.34818 WP_000435132.1.34847 WP_000435132.1.34865 WP_000435132.1.34877 WP_000435132.1.34890 WP_000435132.1.34918 WP_000435132.1.34926 WP_000435132.1.34967 WP_000435132.1.34998 WP_000435132.1.35014 WP_000435132.1.35031 WP_000435132.1.35032 WP_000435132.1.35059 WP_000435132.1.35062 WP_000435132.1.35089 WP_000435132.1.35097 WP_000435132.1.35106 WP_000435132.1.35108 WP_000435132.1.35110 WP_000435132.1.35121 WP_000435132.1.35177 WP_000435132.1.35189 WP_000435132.1.35222 WP_000435132.1.35233 WP_000435132.1.35257 WP_000435132.1.35264 WP_000435132.1.35276 WP_000435132.1.35285 WP_000435132.1.35289 WP_000435132.1.35297 WP_000435132.1.35307 WP_000435132.1.35314 WP_000435132.1.35334 WP_000435132.1.35340 WP_000435132.1.35345 WP_000435132.1.35352 WP_000435132.1.35391 WP_000435132.1.354 WP_000435132.1.35413 WP_000435132.1.35415 WP_000435132.1.3542 WP_000435132.1.35433 WP_000435132.1.35435 WP_000435132.1.3547 WP_000435132.1.35490 WP_000435132.1.35497 WP_000435132.1.35498 WP_000435132.1.35508 WP_000435132.1.35517 WP_000435132.1.35519 WP_000435132.1.3552 WP_000435132.1.35525 WP_000435132.1.35549 WP_000435132.1.35580 WP_000435132.1.35623 WP_000435132.1.35642 WP_000435132.1.35643 WP_000435132.1.35659 WP_000435132.1.35661 WP_000435132.1.35673 WP_000435132.1.3569 WP_000435132.1.35696 WP_000435132.1.35774 WP_000435132.1.35784 WP_000435132.1.3579 WP_000435132.1.35794 WP_000435132.1.35799 WP_000435132.1.35801 WP_000435132.1.35837 WP_000435132.1.35890 WP_000435132.1.35900 WP_000435132.1.35903 WP_000435132.1.35928 WP_000435132.1.35933 WP_000435132.1.35950 WP_000435132.1.36004 WP_000435132.1.36021 WP_000435132.1.36082 WP_000435132.1.36093 WP_000435132.1.36102 WP_000435132.1.36117 WP_000435132.1.36119 WP_000435132.1.36141 WP_000435132.1.3617 WP_000435132.1.36175 WP_000435132.1.36176 WP_000435132.1.36179 WP_000435132.1.36187 WP_000435132.1.36188 WP_000435132.1.36193 WP_000435132.1.36208 WP_000435132.1.36220 WP_000435132.1.36223 WP_000435132.1.3623 WP_000435132.1.36249 WP_000435132.1.36250 WP_000435132.1.36264 WP_000435132.1.36278 WP_000435132.1.36282 WP_000435132.1.36283 WP_000435132.1.36302 WP_000435132.1.36307 WP_000435132.1.36325 WP_000435132.1.36344 WP_000435132.1.36430 WP_000435132.1.36434 WP_000435132.1.36439 WP_000435132.1.36522 WP_000435132.1.36532 WP_000435132.1.36535 WP_000435132.1.3655 WP_000435132.1.36551 WP_000435132.1.36570 WP_000435132.1.36580 WP_000435132.1.36600 WP_000435132.1.36604 WP_000435132.1.36615 WP_000435132.1.36640 WP_000435132.1.36646 WP_000435132.1.3666 WP_000435132.1.36697 WP_000435132.1.36704 WP_000435132.1.36729 WP_000435132.1.36745 WP_000435132.1.3675 WP_000435132.1.36770 WP_000435132.1.36773 WP_000435132.1.36783 WP_000435132.1.36793 WP_000435132.1.36796 WP_000435132.1.36809 WP_000435132.1.36814 WP_000435132.1.36820 WP_000435132.1.36822 WP_000435132.1.36847 WP_000435132.1.3685 WP_000435132.1.36858 WP_000435132.1.3687 WP_000435132.1.36884 WP_000435132.1.36888 WP_000435132.1.36903 WP_000435132.1.36911 WP_000435132.1.36932 WP_000435132.1.36955 WP_000435132.1.36980 WP_000435132.1.36983 WP_000435132.1.36997 WP_000435132.1.37002 WP_000435132.1.37016 WP_000435132.1.3703 WP_000435132.1.37044 WP_000435132.1.37055 WP_000435132.1.37075 WP_000435132.1.37080 WP_000435132.1.37120 WP_000435132.1.37121 WP_000435132.1.37130 WP_000435132.1.37132 WP_000435132.1.37134 WP_000435132.1.37145 WP_000435132.1.37159 WP_000435132.1.3722 WP_000435132.1.37220 WP_000435132.1.37240 WP_000435132.1.37304 WP_000435132.1.37335 WP_000435132.1.37336 WP_000435132.1.37341 WP_000435132.1.37343 WP_000435132.1.37354 WP_000435132.1.37378 WP_000435132.1.37398 WP_000435132.1.37408 WP_000435132.1.37411 WP_000435132.1.37424 WP_000435132.1.37435 WP_000435132.1.37467 WP_000435132.1.37503 WP_000435132.1.37536 WP_000435132.1.37546 WP_000435132.1.37563 WP_000435132.1.37578 WP_000435132.1.37583 WP_000435132.1.37602 WP_000435132.1.37605 WP_000435132.1.37606 WP_000435132.1.37621 WP_000435132.1.37624 WP_000435132.1.37636 WP_000435132.1.37644 WP_000435132.1.37652 WP_000435132.1.37669 WP_000435132.1.37679 WP_000435132.1.3774 WP_000435132.1.37749 WP_000435132.1.3776 WP_000435132.1.37764 WP_000435132.1.37771 WP_000435132.1.37781 WP_000435132.1.37788 WP_000435132.1.37795 WP_000435132.1.37815 WP_000435132.1.37828 WP_000435132.1.37851 WP_000435132.1.37878 WP_000435132.1.37906 WP_000435132.1.37907 WP_000435132.1.37929 WP_000435132.1.37953 WP_000435132.1.37987 WP_000435132.1.38007 WP_000435132.1.38030 WP_000435132.1.38038 WP_000435132.1.38057 WP_000435132.1.38070 WP_000435132.1.38082 WP_000435132.1.3809 WP_000435132.1.38111 WP_000435132.1.38128 WP_000435132.1.38136 WP_000435132.1.38148 WP_000435132.1.38160 WP_000435132.1.38177 WP_000435132.1.3820 WP_000435132.1.38212 WP_000435132.1.38222 WP_000435132.1.38230 WP_000435132.1.38232 WP_000435132.1.3827 WP_000435132.1.38276 WP_000435132.1.38304 WP_000435132.1.38309 WP_000435132.1.38311 WP_000435132.1.38316 WP_000435132.1.38330 WP_000435132.1.38336 WP_000435132.1.38339 WP_000435132.1.38346 WP_000435132.1.38383 WP_000435132.1.38390 WP_000435132.1.3842 WP_000435132.1.38422 WP_000435132.1.38435 WP_000435132.1.38453 WP_000435132.1.38489 WP_000435132.1.38491 WP_000435132.1.38493 WP_000435132.1.38516 WP_000435132.1.3852 WP_000435132.1.38522 WP_000435132.1.38546 WP_000435132.1.38551 WP_000435132.1.38555 WP_000435132.1.38600 WP_000435132.1.38607 WP_000435132.1.38612 WP_000435132.1.38651 WP_000435132.1.38658 WP_000435132.1.38669 WP_000435132.1.3867 WP_000435132.1.38674 WP_000435132.1.38688 WP_000435132.1.38721 WP_000435132.1.3875 WP_000435132.1.38760 WP_000435132.1.38788 WP_000435132.1.38823 WP_000435132.1.38836 WP_000435132.1.38841 WP_000435132.1.38858 WP_000435132.1.38862 WP_000435132.1.38875 WP_000435132.1.38885 WP_000435132.1.38890 WP_000435132.1.38926 WP_000435132.1.38927 WP_000435132.1.38931 WP_000435132.1.3894 WP_000435132.1.38940 WP_000435132.1.38941 WP_000435132.1.38960 WP_000435132.1.38972 WP_000435132.1.38989 WP_000435132.1.390 WP_000435132.1.39012 WP_000435132.1.39014 WP_000435132.1.39017 WP_000435132.1.39026 WP_000435132.1.39043 WP_000435132.1.39053 WP_000435132.1.3906 WP_000435132.1.39080 WP_000435132.1.39089 WP_000435132.1.391 WP_000435132.1.39108 WP_000435132.1.39117 WP_000435132.1.39126 WP_000435132.1.39166 WP_000435132.1.39173 WP_000435132.1.39203 WP_000435132.1.39206 WP_000435132.1.39217 WP_000435132.1.3926 WP_000435132.1.39272 WP_000435132.1.39281 WP_000435132.1.39290 WP_000435132.1.39330 WP_000435132.1.39332 WP_000435132.1.39333 WP_000435132.1.39347 WP_000435132.1.39361 WP_000435132.1.39384 WP_000435132.1.39397 WP_000435132.1.39406 WP_000435132.1.39432 WP_000435132.1.39451 WP_000435132.1.39486 WP_000435132.1.39494 WP_000435132.1.39499 WP_000435132.1.39506 WP_000435132.1.39527 WP_000435132.1.39542 WP_000435132.1.39550 WP_000435132.1.39625 WP_000435132.1.39642 WP_000435132.1.39645 WP_000435132.1.39662 WP_000435132.1.39670 WP_000435132.1.39671 WP_000435132.1.39687 WP_000435132.1.39689 WP_000435132.1.39693 WP_000435132.1.39697 WP_000435132.1.39711 WP_000435132.1.39738 WP_000435132.1.39767 WP_000435132.1.39773 WP_000435132.1.39789 WP_000435132.1.39812 WP_000435132.1.39832 WP_000435132.1.39834 WP_000435132.1.39838 WP_000435132.1.39847 WP_000435132.1.39856 WP_000435132.1.39857 WP_000435132.1.39869 WP_000435132.1.39875 WP_000435132.1.39880 WP_000435132.1.39883 WP_000435132.1.39943 WP_000435132.1.39995 WP_000435132.1.40014 WP_000435132.1.40043 WP_000435132.1.40053 WP_000435132.1.4006 WP_000435132.1.40076 WP_000435132.1.40082 WP_000435132.1.40085 WP_000435132.1.4010 WP_000435132.1.40119 WP_000435132.1.4012 WP_000435132.1.40120 WP_000435132.1.40130 WP_000435132.1.40137 WP_000435132.1.40149 WP_000435132.1.4015 WP_000435132.1.40164 WP_000435132.1.40173 WP_000435132.1.4019 WP_000435132.1.40220 WP_000435132.1.40247 WP_000435132.1.4025 WP_000435132.1.40299 WP_000435132.1.40316 WP_000435132.1.40318 WP_000435132.1.40320 WP_000435132.1.40322 WP_000435132.1.40329 WP_000435132.1.40330 WP_000435132.1.40340 WP_000435132.1.40368 WP_000435132.1.40369 WP_000435132.1.40406 WP_000435132.1.40409 WP_000435132.1.40428 WP_000435132.1.40435 WP_000435132.1.40443 WP_000435132.1.40454 WP_000435132.1.40458 WP_000435132.1.40463 WP_000435132.1.40472 WP_000435132.1.40474 WP_000435132.1.40481 WP_000435132.1.40483 WP_000435132.1.40500 WP_000435132.1.40505 WP_000435132.1.40531 WP_000435132.1.40532 WP_000435132.1.4056 WP_000435132.1.4057 WP_000435132.1.40579 WP_000435132.1.40588 WP_000435132.1.40613 WP_000435132.1.40620 WP_000435132.1.40644 WP_000435132.1.40655 WP_000435132.1.40658 WP_000435132.1.40659 WP_000435132.1.40670 WP_000435132.1.40700 WP_000435132.1.40729 WP_000435132.1.40760 WP_000435132.1.4078 WP_000435132.1.40780 WP_000435132.1.40797 WP_000435132.1.40816 WP_000435132.1.40939 WP_000435132.1.40954 WP_000435132.1.40997 WP_000435132.1.41002 WP_000435132.1.41033 WP_000435132.1.4105 WP_000435132.1.41064 WP_000435132.1.41084 WP_000435132.1.41094 WP_000435132.1.41119 WP_000435132.1.41129 WP_000435132.1.4115 WP_000435132.1.41178 WP_000435132.1.412 WP_000435132.1.41208 WP_000435132.1.41238 WP_000435132.1.41241 WP_000435132.1.41245 WP_000435132.1.41255 WP_000435132.1.41288 WP_000435132.1.41289 WP_000435132.1.4129 WP_000435132.1.41314 WP_000435132.1.41341 WP_000435132.1.41350 WP_000435132.1.41374 WP_000435132.1.4138 WP_000435132.1.41386 WP_000435132.1.41389 WP_000435132.1.41426 WP_000435132.1.41432 WP_000435132.1.41433 WP_000435132.1.41444 WP_000435132.1.41456 WP_000435132.1.41458 WP_000435132.1.41461 WP_000435132.1.41499 WP_000435132.1.41537 WP_000435132.1.41555 WP_000435132.1.41558 WP_000435132.1.41567 WP_000435132.1.41581 WP_000435132.1.41582 WP_000435132.1.41587 WP_000435132.1.41597 WP_000435132.1.41598 WP_000435132.1.41599 WP_000435132.1.4160 WP_000435132.1.41612 WP_000435132.1.4162 WP_000435132.1.41620 WP_000435132.1.41647 WP_000435132.1.41674 WP_000435132.1.41681 WP_000435132.1.4169 WP_000435132.1.41698 WP_000435132.1.41743 WP_000435132.1.41755 WP_000435132.1.41796 WP_000435132.1.4182 WP_000435132.1.41821 WP_000435132.1.41839 WP_000435132.1.41863 WP_000435132.1.4188 WP_000435132.1.41898 WP_000435132.1.41906 WP_000435132.1.41935 WP_000435132.1.41943 WP_000435132.1.41954 WP_000435132.1.41972 WP_000435132.1.41983 WP_000435132.1.41989 WP_000435132.1.420 WP_000435132.1.42003 WP_000435132.1.42005 WP_000435132.1.42015 WP_000435132.1.42017 WP_000435132.1.4202 WP_000435132.1.42028 WP_000435132.1.42072 WP_000435132.1.42085 WP_000435132.1.42087 WP_000435132.1.42125 WP_000435132.1.42137 WP_000435132.1.42169 WP_000435132.1.42177 WP_000435132.1.42178 WP_000435132.1.42198 WP_000435132.1.42230 WP_000435132.1.42241 WP_000435132.1.4225 WP_000435132.1.42269 WP_000435132.1.42298 WP_000435132.1.42305 WP_000435132.1.4231 WP_000435132.1.42325 WP_000435132.1.42336 WP_000435132.1.42344 WP_000435132.1.42355 WP_000435132.1.42403 WP_000435132.1.42436 WP_000435132.1.42438 WP_000435132.1.42455 WP_000435132.1.42459 WP_000435132.1.42481 WP_000435132.1.42503 WP_000435132.1.42510 WP_000435132.1.42517 WP_000435132.1.42593 WP_000435132.1.42598 WP_000435132.1.426 WP_000435132.1.4260 WP_000435132.1.42607 WP_000435132.1.42640 WP_000435132.1.42652 WP_000435132.1.42668 WP_000435132.1.42674 WP_000435132.1.42679 WP_000435132.1.42681 WP_000435132.1.42706 WP_000435132.1.42733 WP_000435132.1.42737 WP_000435132.1.42759 WP_000435132.1.42764 WP_000435132.1.42786 WP_000435132.1.42788 WP_000435132.1.42802 WP_000435132.1.42816 WP_000435132.1.42837 WP_000435132.1.42883 WP_000435132.1.42893 WP_000435132.1.42907 WP_000435132.1.42924 WP_000435132.1.42925 WP_000435132.1.42959 WP_000435132.1.42982 WP_000435132.1.42984 WP_000435132.1.42985 WP_000435132.1.4299 WP_000435132.1.42990 WP_000435132.1.4300 WP_000435132.1.43014 WP_000435132.1.43033 WP_000435132.1.43047 WP_000435132.1.43061 WP_000435132.1.43072 WP_000435132.1.43095 WP_000435132.1.43110 WP_000435132.1.43122 WP_000435132.1.43125 WP_000435132.1.43131 WP_000435132.1.43134 WP_000435132.1.43139 WP_000435132.1.43143 WP_000435132.1.43147 WP_000435132.1.43159 WP_000435132.1.43165 WP_000435132.1.43168 WP_000435132.1.43179 WP_000435132.1.43202 WP_000435132.1.43204 WP_000435132.1.43220 WP_000435132.1.43232 WP_000435132.1.43248 WP_000435132.1.4325 WP_000435132.1.43252 WP_000435132.1.43263 WP_000435132.1.4327 WP_000435132.1.43279 WP_000435132.1.43323 WP_000435132.1.43325 WP_000435132.1.43328 WP_000435132.1.43331 WP_000435132.1.43341 WP_000435132.1.43349 WP_000435132.1.43360 WP_000435132.1.43366 WP_000435132.1.43369 WP_000435132.1.4337 WP_000435132.1.43375 WP_000435132.1.43405 WP_000435132.1.43406 WP_000435132.1.4341 WP_000435132.1.43410 WP_000435132.1.43414 WP_000435132.1.43446 WP_000435132.1.43460 WP_000435132.1.4347 WP_000435132.1.43512 WP_000435132.1.43530 WP_000435132.1.43550 WP_000435132.1.43560 WP_000435132.1.43594 WP_000435132.1.43600 WP_000435132.1.43618 WP_000435132.1.43627 WP_000435132.1.43659 WP_000435132.1.43665 WP_000435132.1.43670 WP_000435132.1.43683 WP_000435132.1.4369 WP_000435132.1.4370 WP_000435132.1.43702 WP_000435132.1.4372 WP_000435132.1.43731 WP_000435132.1.4374 WP_000435132.1.43752 WP_000435132.1.43784 WP_000435132.1.43788 WP_000435132.1.4379 WP_000435132.1.43819 WP_000435132.1.43822 WP_000435132.1.43827 WP_000435132.1.4385 WP_000435132.1.4386 WP_000435132.1.43904 WP_000435132.1.43915 WP_000435132.1.43924 WP_000435132.1.43984 WP_000435132.1.43995 WP_000435132.1.44021 WP_000435132.1.44072 WP_000435132.1.44074 WP_000435132.1.44095 WP_000435132.1.44119 WP_000435132.1.44150 WP_000435132.1.44153 WP_000435132.1.44177 WP_000435132.1.44178 WP_000435132.1.44181 WP_000435132.1.44195 WP_000435132.1.44255 WP_000435132.1.44265 WP_000435132.1.44302 WP_000435132.1.44312 WP_000435132.1.44344 WP_000435132.1.44382 WP_000435132.1.44388 WP_000435132.1.44396 WP_000435132.1.44405 WP_000435132.1.44420 WP_000435132.1.44432 WP_000435132.1.44455 WP_000435132.1.44480 WP_000435132.1.44493 WP_000435132.1.44517 WP_000435132.1.44520 WP_000435132.1.44544 WP_000435132.1.44547 WP_000435132.1.44579 WP_000435132.1.44586 WP_000435132.1.44605 WP_000435132.1.44623 WP_000435132.1.44631 WP_000435132.1.44646 WP_000435132.1.44655 WP_000435132.1.44667 WP_000435132.1.44672 WP_000435132.1.44674 WP_000435132.1.44714 WP_000435132.1.44732 WP_000435132.1.44755 WP_000435132.1.44768 WP_000435132.1.44785 WP_000435132.1.44788 WP_000435132.1.44796 WP_000435132.1.44802 WP_000435132.1.44853 WP_000435132.1.44856 WP_000435132.1.44868 WP_000435132.1.44876 WP_000435132.1.44881 WP_000435132.1.44882 WP_000435132.1.44891 WP_000435132.1.44892 WP_000435132.1.44899 WP_000435132.1.44914 WP_000435132.1.44932 WP_000435132.1.44940 WP_000435132.1.44948 WP_000435132.1.44955 WP_000435132.1.44969 WP_000435132.1.44993 WP_000435132.1.45010 WP_000435132.1.45015 WP_000435132.1.45033 WP_000435132.1.45035 WP_000435132.1.45042 WP_000435132.1.45050 WP_000435132.1.45080 WP_000435132.1.45091 WP_000435132.1.45094 WP_000435132.1.45099 WP_000435132.1.45101 WP_000435132.1.45111 WP_000435132.1.4513 WP_000435132.1.45132 WP_000435132.1.45133 WP_000435132.1.45140 WP_000435132.1.45157 WP_000435132.1.45162 WP_000435132.1.45164 WP_000435132.1.45170 WP_000435132.1.45188 WP_000435132.1.45189 WP_000435132.1.452 WP_000435132.1.45223 WP_000435132.1.45242 WP_000435132.1.45267 WP_000435132.1.4527 WP_000435132.1.45272 WP_000435132.1.45281 WP_000435132.1.45290 WP_000435132.1.45297 WP_000435132.1.45303 WP_000435132.1.45321 WP_000435132.1.45332 WP_000435132.1.45364 WP_000435132.1.45431 WP_000435132.1.45439 WP_000435132.1.45447 WP_000435132.1.4545 WP_000435132.1.45450 WP_000435132.1.45456 WP_000435132.1.4546 WP_000435132.1.45472 WP_000435132.1.4550 WP_000435132.1.45507 WP_000435132.1.45542 WP_000435132.1.45555 WP_000435132.1.45560 WP_000435132.1.45574 WP_000435132.1.45577 WP_000435132.1.45610 WP_000435132.1.45620 WP_000435132.1.45640 WP_000435132.1.45645 WP_000435132.1.45654 WP_000435132.1.45670 WP_000435132.1.45698 WP_000435132.1.45703 WP_000435132.1.45713 WP_000435132.1.45730 WP_000435132.1.45734 WP_000435132.1.45747 WP_000435132.1.45763 WP_000435132.1.45768 WP_000435132.1.4577 WP_000435132.1.45771 WP_000435132.1.45773 WP_000435132.1.45780 WP_000435132.1.4580 WP_000435132.1.4582 WP_000435132.1.45822 WP_000435132.1.45833 WP_000435132.1.45852 WP_000435132.1.45862 WP_000435132.1.45870 WP_000435132.1.45874 WP_000435132.1.45875 WP_000435132.1.45881 WP_000435132.1.45888 WP_000435132.1.45897 WP_000435132.1.459 WP_000435132.1.45954 WP_000435132.1.45972 WP_000435132.1.45977 WP_000435132.1.45979 WP_000435132.1.4598 WP_000435132.1.46003 WP_000435132.1.46005 WP_000435132.1.46021 WP_000435132.1.46037 WP_000435132.1.46050 WP_000435132.1.46055 WP_000435132.1.46062 WP_000435132.1.46071 WP_000435132.1.46078 WP_000435132.1.46087 WP_000435132.1.46106 WP_000435132.1.46136 WP_000435132.1.46168 WP_000435132.1.46172 WP_000435132.1.46195 WP_000435132.1.46208 WP_000435132.1.46212 WP_000435132.1.46222 WP_000435132.1.46228 WP_000435132.1.46259 WP_000435132.1.46276 WP_000435132.1.46289 WP_000435132.1.46320 WP_000435132.1.46330 WP_000435132.1.46333 WP_000435132.1.46334 WP_000435132.1.46339 WP_000435132.1.46353 WP_000435132.1.46362 WP_000435132.1.46368 WP_000435132.1.46380 WP_000435132.1.46389 WP_000435132.1.46401 WP_000435132.1.46418 WP_000435132.1.46422 WP_000435132.1.46457 WP_000435132.1.46465 WP_000435132.1.46488 WP_000435132.1.46514 WP_000435132.1.46528 WP_000435132.1.46534 WP_000435132.1.46543 WP_000435132.1.46576 WP_000435132.1.46608 WP_000435132.1.46619 WP_000435132.1.4662 WP_000435132.1.46648 WP_000435132.1.46660 WP_000435132.1.46664 WP_000435132.1.46670 WP_000435132.1.46688 WP_000435132.1.46692 WP_000435132.1.46696 WP_000435132.1.46702 WP_000435132.1.46703 WP_000435132.1.46720 WP_000435132.1.46736 WP_000435132.1.46752 WP_000435132.1.46765 WP_000435132.1.46767 WP_000435132.1.46770 WP_000435132.1.46772 WP_000435132.1.4680 WP_000435132.1.46815 WP_000435132.1.46823 WP_000435132.1.46837 WP_000435132.1.46875 WP_000435132.1.46881 WP_000435132.1.46908 WP_000435132.1.46911 WP_000435132.1.46925 WP_000435132.1.46929 WP_000435132.1.46937 WP_000435132.1.4694 WP_000435132.1.46947 WP_000435132.1.4696 WP_000435132.1.46964 WP_000435132.1.46983 WP_000435132.1.46995 WP_000435132.1.47002 WP_000435132.1.47051 WP_000435132.1.47065 WP_000435132.1.47090 WP_000435132.1.47105 WP_000435132.1.47107 WP_000435132.1.47111 WP_000435132.1.47128 WP_000435132.1.47153 WP_000435132.1.47159 WP_000435132.1.4716 WP_000435132.1.47163 WP_000435132.1.47205 WP_000435132.1.47211 WP_000435132.1.47216 WP_000435132.1.47218 WP_000435132.1.47250 WP_000435132.1.47258 WP_000435132.1.47269 WP_000435132.1.47279 WP_000435132.1.4728 WP_000435132.1.47282 WP_000435132.1.47290 WP_000435132.1.47294 WP_000435132.1.47306 WP_000435132.1.47308 WP_000435132.1.47317 WP_000435132.1.47328 WP_000435132.1.47334 WP_000435132.1.47381 WP_000435132.1.47383 WP_000435132.1.47399 WP_000435132.1.47405 WP_000435132.1.47406 WP_000435132.1.47408 WP_000435132.1.47422 WP_000435132.1.47426 WP_000435132.1.47432 WP_000435132.1.47439 WP_000435132.1.47450 WP_000435132.1.47459 WP_000435132.1.47493 WP_000435132.1.4752 WP_000435132.1.47522 WP_000435132.1.47530 WP_000435132.1.47541 WP_000435132.1.47554 WP_000435132.1.47560 WP_000435132.1.47570 WP_000435132.1.47577 WP_000435132.1.47617 WP_000435132.1.47618 WP_000435132.1.47629 WP_000435132.1.47667 WP_000435132.1.47669 WP_000435132.1.4767 WP_000435132.1.47680 WP_000435132.1.477 WP_000435132.1.47733 WP_000435132.1.47747 WP_000435132.1.47763 WP_000435132.1.47782 WP_000435132.1.47792 WP_000435132.1.47821 WP_000435132.1.47836 WP_000435132.1.47851 WP_000435132.1.47859 WP_000435132.1.47872 WP_000435132.1.47873 WP_000435132.1.47888 WP_000435132.1.47901 WP_000435132.1.47904 WP_000435132.1.4792 WP_000435132.1.47951 WP_000435132.1.47980 WP_000435132.1.47996 WP_000435132.1.48009 WP_000435132.1.48011 WP_000435132.1.48013 WP_000435132.1.48017 WP_000435132.1.48030 WP_000435132.1.48046 WP_000435132.1.48047 WP_000435132.1.4805 WP_000435132.1.48064 WP_000435132.1.48067 WP_000435132.1.48116 WP_000435132.1.48142 WP_000435132.1.48149 WP_000435132.1.4815 WP_000435132.1.48154 WP_000435132.1.48156 WP_000435132.1.48169 WP_000435132.1.48186 WP_000435132.1.48187 WP_000435132.1.48197 WP_000435132.1.48205 WP_000435132.1.48223 WP_000435132.1.48227 WP_000435132.1.48236 WP_000435132.1.48250 WP_000435132.1.48272 WP_000435132.1.48282 WP_000435132.1.48284 WP_000435132.1.48293 WP_000435132.1.48307 WP_000435132.1.48310 WP_000435132.1.48322 WP_000435132.1.48326 WP_000435132.1.48335 WP_000435132.1.48338 WP_000435132.1.48364 WP_000435132.1.48376 WP_000435132.1.48391 WP_000435132.1.48394 WP_000435132.1.48398 WP_000435132.1.484 WP_000435132.1.4840 WP_000435132.1.48427 WP_000435132.1.48437 WP_000435132.1.48438 WP_000435132.1.48463 WP_000435132.1.48479 WP_000435132.1.48492 WP_000435132.1.4852 WP_000435132.1.48563 WP_000435132.1.48577 WP_000435132.1.48580 WP_000435132.1.48593 WP_000435132.1.48601 WP_000435132.1.48634 WP_000435132.1.48655 WP_000435132.1.48656 WP_000435132.1.48664 WP_000435132.1.48670 WP_000435132.1.4868 WP_000435132.1.48694 WP_000435132.1.48705 WP_000435132.1.48711 WP_000435132.1.48723 WP_000435132.1.48769 WP_000435132.1.48782 WP_000435132.1.48786 WP_000435132.1.48805 WP_000435132.1.48817 WP_000435132.1.48823 WP_000435132.1.48833 WP_000435132.1.48835 WP_000435132.1.4886 WP_000435132.1.48869 WP_000435132.1.48936 WP_000435132.1.48941 WP_000435132.1.48943 WP_000435132.1.48945 WP_000435132.1.48951 WP_000435132.1.48968 WP_000435132.1.48982 WP_000435132.1.48993 WP_000435132.1.48996 WP_000435132.1.4901 WP_000435132.1.49018 WP_000435132.1.49032 WP_000435132.1.4905 WP_000435132.1.49071 WP_000435132.1.49094 WP_000435132.1.49105 WP_000435132.1.49129 WP_000435132.1.49143 WP_000435132.1.49150 WP_000435132.1.49159 WP_000435132.1.4916 WP_000435132.1.49161 WP_000435132.1.4917 WP_000435132.1.49171 WP_000435132.1.49189 WP_000435132.1.49196 WP_000435132.1.49199 WP_000435132.1.4920 WP_000435132.1.49207 WP_000435132.1.4921 WP_000435132.1.49227 WP_000435132.1.4924 WP_000435132.1.49248 WP_000435132.1.49301 WP_000435132.1.49326 WP_000435132.1.49327 WP_000435132.1.49362 WP_000435132.1.49373 WP_000435132.1.49398 WP_000435132.1.49418 WP_000435132.1.4945 WP_000435132.1.49479 WP_000435132.1.49484 WP_000435132.1.4950 WP_000435132.1.49530 WP_000435132.1.49549 WP_000435132.1.49573 WP_000435132.1.49581 WP_000435132.1.49582 WP_000435132.1.496 WP_000435132.1.49603 WP_000435132.1.49605 WP_000435132.1.4962 WP_000435132.1.49643 WP_000435132.1.49653 WP_000435132.1.49658 WP_000435132.1.49669 WP_000435132.1.49671 WP_000435132.1.49672 WP_000435132.1.49690 WP_000435132.1.49707 WP_000435132.1.49728 WP_000435132.1.49730 WP_000435132.1.49732 WP_000435132.1.49742 WP_000435132.1.49745 WP_000435132.1.49757 WP_000435132.1.4980 WP_000435132.1.49800 WP_000435132.1.49819 WP_000435132.1.4982 WP_000435132.1.49825 WP_000435132.1.4984 WP_000435132.1.49860 WP_000435132.1.49863 WP_000435132.1.4987 WP_000435132.1.49871 WP_000435132.1.4989 WP_000435132.1.49894 WP_000435132.1.49912 WP_000435132.1.49917 WP_000435132.1.49918 WP_000435132.1.49934 WP_000435132.1.49935 WP_000435132.1.4994 WP_000435132.1.49943 WP_000435132.1.49951 WP_000435132.1.49970 WP_000435132.1.49982 WP_000435132.1.50013 WP_000435132.1.50023 WP_000435132.1.50038 WP_000435132.1.50039 WP_000435132.1.50061 WP_000435132.1.50064 WP_000435132.1.50071 WP_000435132.1.50076 WP_000435132.1.50117 WP_000435132.1.5013 WP_000435132.1.50138 WP_000435132.1.50145 WP_000435132.1.50175 WP_000435132.1.50178 WP_000435132.1.50192 WP_000435132.1.50212 WP_000435132.1.50217 WP_000435132.1.50219 WP_000435132.1.50261 WP_000435132.1.50291 WP_000435132.1.50313 WP_000435132.1.50314 WP_000435132.1.5035 WP_000435132.1.50356 WP_000435132.1.50367 WP_000435132.1.50369 WP_000435132.1.50377 WP_000435132.1.50388 WP_000435132.1.50424 WP_000435132.1.50425 WP_000435132.1.50430 WP_000435132.1.50440 WP_000435132.1.5045 WP_000435132.1.50464 WP_000435132.1.50477 WP_000435132.1.50525 WP_000435132.1.50527 WP_000435132.1.50536 WP_000435132.1.50543 WP_000435132.1.50555 WP_000435132.1.50556 WP_000435132.1.50558 WP_000435132.1.50568 WP_000435132.1.50578 WP_000435132.1.5059 WP_000435132.1.50594 WP_000435132.1.50595 WP_000435132.1.50647 WP_000435132.1.50660 WP_000435132.1.50699 WP_000435132.1.50711 WP_000435132.1.50732 WP_000435132.1.50745 WP_000435132.1.50748 WP_000435132.1.50768 WP_000435132.1.50799 WP_000435132.1.5080 WP_000435132.1.50817 WP_000435132.1.50829 WP_000435132.1.50884 WP_000435132.1.50896 WP_000435132.1.50937 WP_000435132.1.50958 WP_000435132.1.50962 WP_000435132.1.50974 WP_000435132.1.51015 WP_000435132.1.51031 WP_000435132.1.5108 WP_000435132.1.5110 WP_000435132.1.5111 WP_000435132.1.51130 WP_000435132.1.5117 WP_000435132.1.51194 WP_000435132.1.51209 WP_000435132.1.51220 WP_000435132.1.51236 WP_000435132.1.51245 WP_000435132.1.51250 WP_000435132.1.51271 WP_000435132.1.51277 WP_000435132.1.51282 WP_000435132.1.51295 WP_000435132.1.51306 WP_000435132.1.51310 WP_000435132.1.51326 WP_000435132.1.51346 WP_000435132.1.51376 WP_000435132.1.51403 WP_000435132.1.51418 WP_000435132.1.5145 WP_000435132.1.51454 WP_000435132.1.51456 WP_000435132.1.51469 WP_000435132.1.51492 WP_000435132.1.51496 WP_000435132.1.515 WP_000435132.1.51527 WP_000435132.1.5155 WP_000435132.1.51557 WP_000435132.1.51558 WP_000435132.1.51559 WP_000435132.1.51575 WP_000435132.1.51590 WP_000435132.1.51619 WP_000435132.1.51623 WP_000435132.1.51657 WP_000435132.1.51665 WP_000435132.1.51702 WP_000435132.1.51713 WP_000435132.1.51716 WP_000435132.1.51741 WP_000435132.1.51748 WP_000435132.1.51751 WP_000435132.1.51794 WP_000435132.1.51797 WP_000435132.1.51824 WP_000435132.1.51836 WP_000435132.1.51842 WP_000435132.1.5186 WP_000435132.1.51866 WP_000435132.1.51871 WP_000435132.1.51883 WP_000435132.1.51924 WP_000435132.1.51936 WP_000435132.1.51952 WP_000435132.1.51971 WP_000435132.1.51973 WP_000435132.1.51995 WP_000435132.1.52034 WP_000435132.1.52061 WP_000435132.1.52072 WP_000435132.1.52078 WP_000435132.1.5209 WP_000435132.1.521 WP_000435132.1.5213 WP_000435132.1.52151 WP_000435132.1.52182 WP_000435132.1.52185 WP_000435132.1.52193 WP_000435132.1.52195 WP_000435132.1.52198 WP_000435132.1.52210 WP_000435132.1.52224 WP_000435132.1.52251 WP_000435132.1.5228 WP_000435132.1.52289 WP_000435132.1.52296 WP_000435132.1.523 WP_000435132.1.52308 WP_000435132.1.5231 WP_000435132.1.52322 WP_000435132.1.52327 WP_000435132.1.52331 WP_000435132.1.52343 WP_000435132.1.52377 WP_000435132.1.52396 WP_000435132.1.52427 WP_000435132.1.52436 WP_000435132.1.52440 WP_000435132.1.52442 WP_000435132.1.52452 WP_000435132.1.52463 WP_000435132.1.52474 WP_000435132.1.5251 WP_000435132.1.52511 WP_000435132.1.52518 WP_000435132.1.52548 WP_000435132.1.52595 WP_000435132.1.52602 WP_000435132.1.52605 WP_000435132.1.52622 WP_000435132.1.52623 WP_000435132.1.52624 WP_000435132.1.52645 WP_000435132.1.52660 WP_000435132.1.52687 WP_000435132.1.52699 WP_000435132.1.52715 WP_000435132.1.52722 WP_000435132.1.52754 WP_000435132.1.52828 WP_000435132.1.52830 WP_000435132.1.52836 WP_000435132.1.52848 WP_000435132.1.52865 WP_000435132.1.52877 WP_000435132.1.52878 WP_000435132.1.52889 WP_000435132.1.52893 WP_000435132.1.52900 WP_000435132.1.52941 WP_000435132.1.52947 WP_000435132.1.52965 WP_000435132.1.52983 WP_000435132.1.52984 WP_000435132.1.52992 WP_000435132.1.53022 WP_000435132.1.5304 WP_000435132.1.53050 WP_000435132.1.53057 WP_000435132.1.53060 WP_000435132.1.53069 WP_000435132.1.53071 WP_000435132.1.53109 WP_000435132.1.53140 WP_000435132.1.53153 WP_000435132.1.53178 WP_000435132.1.53189 WP_000435132.1.5319 WP_000435132.1.53209 WP_000435132.1.53245 WP_000435132.1.53260 WP_000435132.1.53285 WP_000435132.1.53312 WP_000435132.1.53317 WP_000435132.1.53319 WP_000435132.1.53323 WP_000435132.1.5336 WP_000435132.1.53363 WP_000435132.1.53366 WP_000435132.1.53372 WP_000435132.1.53373 WP_000435132.1.53379 WP_000435132.1.53383 WP_000435132.1.53387 WP_000435132.1.53394 WP_000435132.1.53403 WP_000435132.1.53408 WP_000435132.1.53418 WP_000435132.1.53432 WP_000435132.1.53433 WP_000435132.1.53444 WP_000435132.1.53462 WP_000435132.1.53467 WP_000435132.1.5347 WP_000435132.1.53521 WP_000435132.1.53532 WP_000435132.1.53577 WP_000435132.1.5359 WP_000435132.1.53641 WP_000435132.1.53648 WP_000435132.1.53671 WP_000435132.1.53758 WP_000435132.1.53759 WP_000435132.1.53766 WP_000435132.1.53774 WP_000435132.1.53799 WP_000435132.1.5382 WP_000435132.1.53827 WP_000435132.1.53835 WP_000435132.1.53886 WP_000435132.1.53889 WP_000435132.1.53911 WP_000435132.1.53915 WP_000435132.1.53924 WP_000435132.1.53926 WP_000435132.1.53934 WP_000435132.1.53969 WP_000435132.1.53999 WP_000435132.1.5401 WP_000435132.1.54022 WP_000435132.1.54029 WP_000435132.1.54048 WP_000435132.1.54049 WP_000435132.1.54074 WP_000435132.1.54086 WP_000435132.1.54094 WP_000435132.1.54105 WP_000435132.1.54109 WP_000435132.1.54147 WP_000435132.1.54161 WP_000435132.1.54199 WP_000435132.1.54229 WP_000435132.1.54237 WP_000435132.1.54246 WP_000435132.1.54253 WP_000435132.1.54282 WP_000435132.1.54290 WP_000435132.1.54297 WP_000435132.1.54299 WP_000435132.1.54332 WP_000435132.1.54395 WP_000435132.1.544 WP_000435132.1.54404 WP_000435132.1.54413 WP_000435132.1.54426 WP_000435132.1.54438 WP_000435132.1.54446 WP_000435132.1.54471 WP_000435132.1.54479 WP_000435132.1.54485 WP_000435132.1.54503 WP_000435132.1.54510 WP_000435132.1.54518 WP_000435132.1.54539 WP_000435132.1.54551 WP_000435132.1.54554 WP_000435132.1.54572 WP_000435132.1.54574 WP_000435132.1.54637 WP_000435132.1.54675 WP_000435132.1.54689 WP_000435132.1.5469 WP_000435132.1.54733 WP_000435132.1.54744 WP_000435132.1.54745 WP_000435132.1.54753 WP_000435132.1.54819 WP_000435132.1.54826 WP_000435132.1.54830 WP_000435132.1.54851 WP_000435132.1.54878 WP_000435132.1.54895 WP_000435132.1.54929 WP_000435132.1.54931 WP_000435132.1.54967 WP_000435132.1.54990 WP_000435132.1.54995 WP_000435132.1.5500 WP_000435132.1.55004 WP_000435132.1.55014 WP_000435132.1.55082 WP_000435132.1.55084 WP_000435132.1.55095 WP_000435132.1.55100 WP_000435132.1.5518 WP_000435132.1.5519 WP_000435132.1.55192 WP_000435132.1.552 WP_000435132.1.55214 WP_000435132.1.55220 WP_000435132.1.55239 WP_000435132.1.55271 WP_000435132.1.55272 WP_000435132.1.55274 WP_000435132.1.55301 WP_000435132.1.55306 WP_000435132.1.55309 WP_000435132.1.55327 WP_000435132.1.55336 WP_000435132.1.55367 WP_000435132.1.55369 WP_000435132.1.55403 WP_000435132.1.55405 WP_000435132.1.55419 WP_000435132.1.55421 WP_000435132.1.55442 WP_000435132.1.55495 WP_000435132.1.5550 WP_000435132.1.55508 WP_000435132.1.55527 WP_000435132.1.55535 WP_000435132.1.55538 WP_000435132.1.5554 WP_000435132.1.55544 WP_000435132.1.55558 WP_000435132.1.5556 WP_000435132.1.55573 WP_000435132.1.5559 WP_000435132.1.55603 WP_000435132.1.5562 WP_000435132.1.55628 WP_000435132.1.55637 WP_000435132.1.55653 WP_000435132.1.557 WP_000435132.1.55719 WP_000435132.1.55724 WP_000435132.1.55728 WP_000435132.1.55746 WP_000435132.1.55784 WP_000435132.1.55786 WP_000435132.1.5580 WP_000435132.1.55818 WP_000435132.1.55831 WP_000435132.1.55835 WP_000435132.1.55845 WP_000435132.1.55854 WP_000435132.1.55867 WP_000435132.1.55874 WP_000435132.1.55886 WP_000435132.1.5589 WP_000435132.1.5590 WP_000435132.1.55904 WP_000435132.1.55916 WP_000435132.1.55933 WP_000435132.1.55953 WP_000435132.1.55955 WP_000435132.1.55985 WP_000435132.1.55991 WP_000435132.1.56000 WP_000435132.1.56003 WP_000435132.1.56025 WP_000435132.1.56039 WP_000435132.1.5604 WP_000435132.1.56048 WP_000435132.1.5606 WP_000435132.1.56064 WP_000435132.1.56078 WP_000435132.1.56098 WP_000435132.1.56106 WP_000435132.1.56135 WP_000435132.1.56153 WP_000435132.1.56159 WP_000435132.1.56214 WP_000435132.1.56220 WP_000435132.1.56225 WP_000435132.1.56237 WP_000435132.1.56239 WP_000435132.1.56265 WP_000435132.1.56281 WP_000435132.1.56306 WP_000435132.1.56332 WP_000435132.1.56333 WP_000435132.1.56343 WP_000435132.1.5635 WP_000435132.1.5637 WP_000435132.1.56377 WP_000435132.1.56387 WP_000435132.1.56400 WP_000435132.1.5644 WP_000435132.1.56444 WP_000435132.1.56453 WP_000435132.1.56496 WP_000435132.1.56527 WP_000435132.1.56542 WP_000435132.1.56558 WP_000435132.1.56570 WP_000435132.1.5658 WP_000435132.1.56584 WP_000435132.1.56598 WP_000435132.1.566 WP_000435132.1.56608 WP_000435132.1.56619 WP_000435132.1.56628 WP_000435132.1.56641 WP_000435132.1.5665 WP_000435132.1.56658 WP_000435132.1.5666 WP_000435132.1.56696 WP_000435132.1.56702 WP_000435132.1.56708 WP_000435132.1.56722 WP_000435132.1.56723 WP_000435132.1.56737 WP_000435132.1.5675 WP_000435132.1.5677 WP_000435132.1.56772 WP_000435132.1.56778 WP_000435132.1.56779 WP_000435132.1.56794 WP_000435132.1.56803 WP_000435132.1.56806 WP_000435132.1.56815 WP_000435132.1.56822 WP_000435132.1.5686 WP_000435132.1.56865 WP_000435132.1.56878 WP_000435132.1.569 WP_000435132.1.56903 WP_000435132.1.56931 WP_000435132.1.56966 WP_000435132.1.56967 WP_000435132.1.56975 WP_000435132.1.56986 WP_000435132.1.57015 WP_000435132.1.57047 WP_000435132.1.5705 WP_000435132.1.57073 WP_000435132.1.57075 WP_000435132.1.57080 WP_000435132.1.57081 WP_000435132.1.57097 WP_000435132.1.57102 WP_000435132.1.57109 WP_000435132.1.57115 WP_000435132.1.57141 WP_000435132.1.57170 WP_000435132.1.57175 WP_000435132.1.57196 WP_000435132.1.57214 WP_000435132.1.57223 WP_000435132.1.57265 WP_000435132.1.57309 WP_000435132.1.57316 WP_000435132.1.57330 WP_000435132.1.57338 WP_000435132.1.57370 WP_000435132.1.57376 WP_000435132.1.57448 WP_000435132.1.57481 WP_000435132.1.57507 WP_000435132.1.5752 WP_000435132.1.57593 WP_000435132.1.57594 WP_000435132.1.57614 WP_000435132.1.5763 WP_000435132.1.57650 WP_000435132.1.57665 WP_000435132.1.57670 WP_000435132.1.57682 WP_000435132.1.57692 WP_000435132.1.57693 WP_000435132.1.5770 WP_000435132.1.57701 WP_000435132.1.57718 WP_000435132.1.57720 WP_000435132.1.57723 WP_000435132.1.57730 WP_000435132.1.57734 WP_000435132.1.57745 WP_000435132.1.57754 WP_000435132.1.57761 WP_000435132.1.57770 WP_000435132.1.57783 WP_000435132.1.57808 WP_000435132.1.57819 WP_000435132.1.57837 WP_000435132.1.57840 WP_000435132.1.57844 WP_000435132.1.57861 WP_000435132.1.57875 WP_000435132.1.57878 WP_000435132.1.57883 WP_000435132.1.57888 WP_000435132.1.579 WP_000435132.1.5791 WP_000435132.1.57910 WP_000435132.1.57915 WP_000435132.1.57943 WP_000435132.1.57944 WP_000435132.1.57952 WP_000435132.1.57962 WP_000435132.1.57974 WP_000435132.1.5799 WP_000435132.1.58005 WP_000435132.1.58006 WP_000435132.1.58014 WP_000435132.1.58016 WP_000435132.1.58017 WP_000435132.1.58035 WP_000435132.1.58042 WP_000435132.1.58049 WP_000435132.1.58050 WP_000435132.1.58074 WP_000435132.1.58106 WP_000435132.1.58116 WP_000435132.1.58122 WP_000435132.1.58127 WP_000435132.1.58148 WP_000435132.1.5816 WP_000435132.1.58175 WP_000435132.1.58185 WP_000435132.1.58198 WP_000435132.1.58212 WP_000435132.1.58241 WP_000435132.1.58242 WP_000435132.1.58246 WP_000435132.1.58317 WP_000435132.1.5832 WP_000435132.1.58321 WP_000435132.1.58325 WP_000435132.1.58350 WP_000435132.1.58352 WP_000435132.1.58353 WP_000435132.1.58366 WP_000435132.1.58373 WP_000435132.1.58388 WP_000435132.1.58392 WP_000435132.1.58413 WP_000435132.1.58419 WP_000435132.1.58421 WP_000435132.1.58430 WP_000435132.1.58435 WP_000435132.1.58473 WP_000435132.1.58481 WP_000435132.1.5849 WP_000435132.1.58495 WP_000435132.1.58504 WP_000435132.1.58508 WP_000435132.1.58512 WP_000435132.1.58521 WP_000435132.1.58530 WP_000435132.1.58538 WP_000435132.1.58549 WP_000435132.1.5857 WP_000435132.1.58571 WP_000435132.1.58592 WP_000435132.1.58598 WP_000435132.1.586 WP_000435132.1.58603 WP_000435132.1.58686 WP_000435132.1.58701 WP_000435132.1.58704 WP_000435132.1.58714 WP_000435132.1.58735 WP_000435132.1.58760 WP_000435132.1.58763 WP_000435132.1.58772 WP_000435132.1.58798 WP_000435132.1.5880 WP_000435132.1.58833 WP_000435132.1.58839 WP_000435132.1.58934 WP_000435132.1.58936 WP_000435132.1.58960 WP_000435132.1.58981 WP_000435132.1.58991 WP_000435132.1.58998 WP_000435132.1.5901 WP_000435132.1.59011 WP_000435132.1.59014 WP_000435132.1.59039 WP_000435132.1.5904 WP_000435132.1.59077 WP_000435132.1.59098 WP_000435132.1.59133 WP_000435132.1.59135 WP_000435132.1.59146 WP_000435132.1.59157 WP_000435132.1.59175 WP_000435132.1.59187 WP_000435132.1.5920 WP_000435132.1.59203 WP_000435132.1.59213 WP_000435132.1.5925 WP_000435132.1.59269 WP_000435132.1.59284 WP_000435132.1.5930 WP_000435132.1.59311 WP_000435132.1.59327 WP_000435132.1.59329 WP_000435132.1.59337 WP_000435132.1.59363 WP_000435132.1.59397 WP_000435132.1.59398 WP_000435132.1.5940 WP_000435132.1.59401 WP_000435132.1.59404 WP_000435132.1.59441 WP_000435132.1.59457 WP_000435132.1.59459 WP_000435132.1.59462 WP_000435132.1.59464 WP_000435132.1.59467 WP_000435132.1.59478 WP_000435132.1.59498 WP_000435132.1.59540 WP_000435132.1.59546 WP_000435132.1.59567 WP_000435132.1.59598 WP_000435132.1.59603 WP_000435132.1.59629 WP_000435132.1.59643 WP_000435132.1.59663 WP_000435132.1.59668 WP_000435132.1.59669 WP_000435132.1.59671 WP_000435132.1.59697 WP_000435132.1.5972 WP_000435132.1.59736 WP_000435132.1.59787 WP_000435132.1.59803 WP_000435132.1.59810 WP_000435132.1.59819 WP_000435132.1.5982 WP_000435132.1.59822 WP_000435132.1.59874 WP_000435132.1.59881 WP_000435132.1.59886 WP_000435132.1.59896 WP_000435132.1.59907 WP_000435132.1.59915 WP_000435132.1.59977 WP_000435132.1.60001 WP_000435132.1.60006 WP_000435132.1.60022 WP_000435132.1.60086 WP_000435132.1.60107 WP_000435132.1.6011 WP_000435132.1.60123 WP_000435132.1.60124 WP_000435132.1.60147 WP_000435132.1.60149 WP_000435132.1.60156 WP_000435132.1.60157 WP_000435132.1.60165 WP_000435132.1.6017 WP_000435132.1.602 WP_000435132.1.60201 WP_000435132.1.60227 WP_000435132.1.60251 WP_000435132.1.60259 WP_000435132.1.60280 WP_000435132.1.60289 WP_000435132.1.60302 WP_000435132.1.60307 WP_000435132.1.6034 WP_000435132.1.60345 WP_000435132.1.60353 WP_000435132.1.60360 WP_000435132.1.60368 WP_000435132.1.60382 WP_000435132.1.60414 WP_000435132.1.60434 WP_000435132.1.6045 WP_000435132.1.60462 WP_000435132.1.60473 WP_000435132.1.60492 WP_000435132.1.60493 WP_000435132.1.60515 WP_000435132.1.60530 WP_000435132.1.60547 WP_000435132.1.60585 WP_000435132.1.60594 WP_000435132.1.60595 WP_000435132.1.60636 WP_000435132.1.60641 WP_000435132.1.60675 WP_000435132.1.60677 WP_000435132.1.60690 WP_000435132.1.60696 WP_000435132.1.60704 WP_000435132.1.60734 WP_000435132.1.60750 WP_000435132.1.60751 WP_000435132.1.60758 WP_000435132.1.60759 WP_000435132.1.60765 WP_000435132.1.60778 WP_000435132.1.60787 WP_000435132.1.60813 WP_000435132.1.60820 WP_000435132.1.60845 WP_000435132.1.6085 WP_000435132.1.60869 WP_000435132.1.60888 WP_000435132.1.60898 WP_000435132.1.60912 WP_000435132.1.60923 WP_000435132.1.60939 WP_000435132.1.60943 WP_000435132.1.60946 WP_000435132.1.60948 WP_000435132.1.60949 WP_000435132.1.60965 WP_000435132.1.60981 WP_000435132.1.61009 WP_000435132.1.61013 WP_000435132.1.61023 WP_000435132.1.61026 WP_000435132.1.61029 WP_000435132.1.61030 WP_000435132.1.61031 WP_000435132.1.61077 WP_000435132.1.61082 WP_000435132.1.61107 WP_000435132.1.61115 WP_000435132.1.61119 WP_000435132.1.61139 WP_000435132.1.61153 WP_000435132.1.6118 WP_000435132.1.61187 WP_000435132.1.61188 WP_000435132.1.61189 WP_000435132.1.6119 WP_000435132.1.61215 WP_000435132.1.61224 WP_000435132.1.6123 WP_000435132.1.61257 WP_000435132.1.61261 WP_000435132.1.61263 WP_000435132.1.61271 WP_000435132.1.61277 WP_000435132.1.61286 WP_000435132.1.61289 WP_000435132.1.61313 WP_000435132.1.61316 WP_000435132.1.61324 WP_000435132.1.61327 WP_000435132.1.6136 WP_000435132.1.61375 WP_000435132.1.61393 WP_000435132.1.61394 WP_000435132.1.61413 WP_000435132.1.61421 WP_000435132.1.61430 WP_000435132.1.61439 WP_000435132.1.61440 WP_000435132.1.61534 WP_000435132.1.61547 WP_000435132.1.61555 WP_000435132.1.61564 WP_000435132.1.61585 WP_000435132.1.61591 WP_000435132.1.61597 WP_000435132.1.61615 WP_000435132.1.61641 WP_000435132.1.6166 WP_000435132.1.6168 WP_000435132.1.61687 WP_000435132.1.6170 WP_000435132.1.61705 WP_000435132.1.61747 WP_000435132.1.61749 WP_000435132.1.61784 WP_000435132.1.61800 WP_000435132.1.61802 WP_000435132.1.61838 WP_000435132.1.61864 WP_000435132.1.6189 WP_000435132.1.61897 WP_000435132.1.61899 WP_000435132.1.619 WP_000435132.1.61903 WP_000435132.1.61910 WP_000435132.1.61921 WP_000435132.1.61936 WP_000435132.1.61970 WP_000435132.1.61975 WP_000435132.1.61978 WP_000435132.1.62002 WP_000435132.1.6201 WP_000435132.1.62028 WP_000435132.1.62030 WP_000435132.1.62069 WP_000435132.1.62071 WP_000435132.1.6208 WP_000435132.1.62093 WP_000435132.1.62096 WP_000435132.1.62140 WP_000435132.1.62160 WP_000435132.1.62164 WP_000435132.1.62229 WP_000435132.1.62247 WP_000435132.1.62253 WP_000435132.1.62254 WP_000435132.1.62265 WP_000435132.1.62318 WP_000435132.1.62346 WP_000435132.1.62352 WP_000435132.1.62382 WP_000435132.1.62383 WP_000435132.1.62398 WP_000435132.1.62409 WP_000435132.1.62414 WP_000435132.1.62416 WP_000435132.1.62429 WP_000435132.1.62453 WP_000435132.1.62459 WP_000435132.1.62474 WP_000435132.1.62482 WP_000435132.1.62492 WP_000435132.1.62496 WP_000435132.1.6250 WP_000435132.1.62537 WP_000435132.1.62553 WP_000435132.1.62575 WP_000435132.1.62602 WP_000435132.1.62621 WP_000435132.1.62625 WP_000435132.1.62653 WP_000435132.1.62671 WP_000435132.1.62674 WP_000435132.1.6268 WP_000435132.1.62684 WP_000435132.1.62685 WP_000435132.1.62723 WP_000435132.1.62740 WP_000435132.1.62756 WP_000435132.1.62764 WP_000435132.1.62771 WP_000435132.1.62781 WP_000435132.1.62796 WP_000435132.1.62808 WP_000435132.1.62822 WP_000435132.1.62824 WP_000435132.1.62831 WP_000435132.1.62842 WP_000435132.1.62863 WP_000435132.1.62878 WP_000435132.1.62880 WP_000435132.1.62927 WP_000435132.1.62956 WP_000435132.1.62970 WP_000435132.1.62974 WP_000435132.1.6298 WP_000435132.1.62998 WP_000435132.1.63003 WP_000435132.1.63004 WP_000435132.1.63011 WP_000435132.1.63027 WP_000435132.1.63047 WP_000435132.1.63050 WP_000435132.1.63051 WP_000435132.1.63062 WP_000435132.1.63068 WP_000435132.1.63070 WP_000435132.1.63083 WP_000435132.1.63085 WP_000435132.1.63120 WP_000435132.1.63132 WP_000435132.1.63139 WP_000435132.1.63142 WP_000435132.1.63143 WP_000435132.1.63162 WP_000435132.1.63182 WP_000435132.1.63190 WP_000435132.1.63195 WP_000435132.1.63215 WP_000435132.1.63220 WP_000435132.1.63228 WP_000435132.1.63233 WP_000435132.1.63244 WP_000435132.1.63266 WP_000435132.1.63273 WP_000435132.1.63279 WP_000435132.1.63280 WP_000435132.1.63289 WP_000435132.1.63296 WP_000435132.1.63304 WP_000435132.1.63313 WP_000435132.1.63319 WP_000435132.1.63322 WP_000435132.1.63324 WP_000435132.1.63333 WP_000435132.1.63335 WP_000435132.1.63337 WP_000435132.1.63341 WP_000435132.1.63364 WP_000435132.1.63365 WP_000435132.1.63383 WP_000435132.1.634 WP_000435132.1.63406 WP_000435132.1.63411 WP_000435132.1.63421 WP_000435132.1.63460 WP_000435132.1.63469 WP_000435132.1.63471 WP_000435132.1.63527 WP_000435132.1.63565 WP_000435132.1.63589 WP_000435132.1.63617 WP_000435132.1.63678 WP_000435132.1.63693 WP_000435132.1.63705 WP_000435132.1.63726 WP_000435132.1.63729 WP_000435132.1.6374 WP_000435132.1.63751 WP_000435132.1.63759 WP_000435132.1.63760 WP_000435132.1.63774 WP_000435132.1.6378 WP_000435132.1.63828 WP_000435132.1.63847 WP_000435132.1.63874 WP_000435132.1.6388 WP_000435132.1.63894 WP_000435132.1.63895 WP_000435132.1.63907 WP_000435132.1.63923 WP_000435132.1.63937 WP_000435132.1.63947 WP_000435132.1.63975 WP_000435132.1.63987 WP_000435132.1.64012 WP_000435132.1.6403 WP_000435132.1.6408 WP_000435132.1.64094 WP_000435132.1.64105 WP_000435132.1.64108 WP_000435132.1.6412 WP_000435132.1.64127 WP_000435132.1.642 WP_000435132.1.64207 WP_000435132.1.64230 WP_000435132.1.64234 WP_000435132.1.64250 WP_000435132.1.64251 WP_000435132.1.64303 WP_000435132.1.64304 WP_000435132.1.64334 WP_000435132.1.64351 WP_000435132.1.64367 WP_000435132.1.64368 WP_000435132.1.6438 WP_000435132.1.64396 WP_000435132.1.64397 WP_000435132.1.64440 WP_000435132.1.64456 WP_000435132.1.64457 WP_000435132.1.64473 WP_000435132.1.64525 WP_000435132.1.64583 WP_000435132.1.6459 WP_000435132.1.6462 WP_000435132.1.64628 WP_000435132.1.64630 WP_000435132.1.64631 WP_000435132.1.64643 WP_000435132.1.64665 WP_000435132.1.64677 WP_000435132.1.64686 WP_000435132.1.64720 WP_000435132.1.64765 WP_000435132.1.6479 WP_000435132.1.64811 WP_000435132.1.64845 WP_000435132.1.64858 WP_000435132.1.64860 WP_000435132.1.64873 WP_000435132.1.64879 WP_000435132.1.6488 WP_000435132.1.64893 WP_000435132.1.64896 WP_000435132.1.64897 WP_000435132.1.64899 WP_000435132.1.64928 WP_000435132.1.64935 WP_000435132.1.64956 WP_000435132.1.64961 WP_000435132.1.64988 WP_000435132.1.64994 WP_000435132.1.64996 WP_000435132.1.64998 WP_000435132.1.65025 WP_000435132.1.65038 WP_000435132.1.65044 WP_000435132.1.65046 WP_000435132.1.65076 WP_000435132.1.65082 WP_000435132.1.65125 WP_000435132.1.65132 WP_000435132.1.65153 WP_000435132.1.65156 WP_000435132.1.65158 WP_000435132.1.65180 WP_000435132.1.65193 WP_000435132.1.65203 WP_000435132.1.65214 WP_000435132.1.65217 WP_000435132.1.65233 WP_000435132.1.65243 WP_000435132.1.65259 WP_000435132.1.65264 WP_000435132.1.6531 WP_000435132.1.65317 WP_000435132.1.65346 WP_000435132.1.65358 WP_000435132.1.65361 WP_000435132.1.65367 WP_000435132.1.65387 WP_000435132.1.65406 WP_000435132.1.65407 WP_000435132.1.65419 WP_000435132.1.65423 WP_000435132.1.65432 WP_000435132.1.6544 WP_000435132.1.65443 WP_000435132.1.65448 WP_000435132.1.65451 WP_000435132.1.6547 WP_000435132.1.65470 WP_000435132.1.65504 WP_000435132.1.6551 WP_000435132.1.65512 WP_000435132.1.65520 WP_000435132.1.65541 WP_000435132.1.65544 WP_000435132.1.65555 WP_000435132.1.65562 WP_000435132.1.65585 WP_000435132.1.6559 WP_000435132.1.65616 WP_000435132.1.65629 WP_000435132.1.65643 WP_000435132.1.65653 WP_000435132.1.65656 WP_000435132.1.65663 WP_000435132.1.65675 WP_000435132.1.6568 WP_000435132.1.65689 WP_000435132.1.65693 WP_000435132.1.65700 WP_000435132.1.65703 WP_000435132.1.65705 WP_000435132.1.65713 WP_000435132.1.65717 WP_000435132.1.65734 WP_000435132.1.65750 WP_000435132.1.65752 WP_000435132.1.65769 WP_000435132.1.65808 WP_000435132.1.65809 WP_000435132.1.65842 WP_000435132.1.6585 WP_000435132.1.65856 WP_000435132.1.65870 WP_000435132.1.65879 WP_000435132.1.65892 WP_000435132.1.65930 WP_000435132.1.65931 WP_000435132.1.65935 WP_000435132.1.65946 WP_000435132.1.65947 WP_000435132.1.65948 WP_000435132.1.65965 WP_000435132.1.65986 WP_000435132.1.66009 WP_000435132.1.66035 WP_000435132.1.66054 WP_000435132.1.66069 WP_000435132.1.66073 WP_000435132.1.66081 WP_000435132.1.661 WP_000435132.1.6612 WP_000435132.1.66130 WP_000435132.1.66133 WP_000435132.1.66144 WP_000435132.1.66175 WP_000435132.1.66262 WP_000435132.1.66265 WP_000435132.1.66281 WP_000435132.1.66298 WP_000435132.1.66302 WP_000435132.1.6632 WP_000435132.1.66322 WP_000435132.1.66366 WP_000435132.1.66369 WP_000435132.1.66433 WP_000435132.1.66453 WP_000435132.1.66482 WP_000435132.1.66505 WP_000435132.1.66513 WP_000435132.1.66519 WP_000435132.1.66542 WP_000435132.1.66554 WP_000435132.1.66556 WP_000435132.1.66576 WP_000435132.1.66588 WP_000435132.1.66598 WP_000435132.1.66601 WP_000435132.1.66606 WP_000435132.1.66611 WP_000435132.1.66614 WP_000435132.1.66628 WP_000435132.1.66655 WP_000435132.1.66664 WP_000435132.1.66677 WP_000435132.1.66705 WP_000435132.1.66711 WP_000435132.1.66712 WP_000435132.1.66726 WP_000435132.1.6674 WP_000435132.1.66756 WP_000435132.1.66765 WP_000435132.1.66766 WP_000435132.1.66786 WP_000435132.1.66803 WP_000435132.1.66816 WP_000435132.1.66818 WP_000435132.1.6684 WP_000435132.1.6688 WP_000435132.1.66969 WP_000435132.1.66979 WP_000435132.1.66996 WP_000435132.1.6700 WP_000435132.1.67006 WP_000435132.1.67012 WP_000435132.1.67014 WP_000435132.1.67063 WP_000435132.1.67067 WP_000435132.1.67072 WP_000435132.1.67090 WP_000435132.1.67112 WP_000435132.1.67135 WP_000435132.1.67147 WP_000435132.1.67155 WP_000435132.1.67160 WP_000435132.1.67191 WP_000435132.1.67204 WP_000435132.1.67212 WP_000435132.1.6722 WP_000435132.1.67238 WP_000435132.1.67251 WP_000435132.1.67259 WP_000435132.1.6726 WP_000435132.1.67266 WP_000435132.1.67286 WP_000435132.1.67294 WP_000435132.1.67296 WP_000435132.1.67297 WP_000435132.1.67328 WP_000435132.1.67329 WP_000435132.1.67333 WP_000435132.1.67379 WP_000435132.1.67386 WP_000435132.1.6740 WP_000435132.1.67414 WP_000435132.1.67418 WP_000435132.1.67420 WP_000435132.1.67425 WP_000435132.1.67447 WP_000435132.1.67457 WP_000435132.1.67460 WP_000435132.1.67463 WP_000435132.1.67480 WP_000435132.1.67505 WP_000435132.1.67507 WP_000435132.1.67513 WP_000435132.1.67520 WP_000435132.1.67521 WP_000435132.1.67540 WP_000435132.1.67554 WP_000435132.1.67571 WP_000435132.1.67572 WP_000435132.1.67609 WP_000435132.1.67612 WP_000435132.1.67618 WP_000435132.1.67621 WP_000435132.1.67632 WP_000435132.1.67644 WP_000435132.1.67651 WP_000435132.1.67652 WP_000435132.1.67653 WP_000435132.1.67691 WP_000435132.1.67703 WP_000435132.1.67712 WP_000435132.1.67713 WP_000435132.1.67722 WP_000435132.1.67752 WP_000435132.1.67754 WP_000435132.1.67767 WP_000435132.1.67806 WP_000435132.1.67815 WP_000435132.1.67834 WP_000435132.1.6786 WP_000435132.1.67864 WP_000435132.1.67865 WP_000435132.1.67867 WP_000435132.1.67880 WP_000435132.1.67889 WP_000435132.1.67900 WP_000435132.1.67925 WP_000435132.1.67941 WP_000435132.1.67986 WP_000435132.1.67991 WP_000435132.1.68001 WP_000435132.1.68054 WP_000435132.1.68066 WP_000435132.1.68101 WP_000435132.1.68102 WP_000435132.1.6811 WP_000435132.1.68111 WP_000435132.1.68134 WP_000435132.1.68139 WP_000435132.1.68141 WP_000435132.1.68160 WP_000435132.1.68199 WP_000435132.1.68202 WP_000435132.1.68219 WP_000435132.1.68221 WP_000435132.1.68223 WP_000435132.1.6824 WP_000435132.1.68261 WP_000435132.1.68268 WP_000435132.1.68286 WP_000435132.1.68295 WP_000435132.1.68299 WP_000435132.1.6830 WP_000435132.1.6834 WP_000435132.1.68343 WP_000435132.1.68351 WP_000435132.1.68355 WP_000435132.1.68366 WP_000435132.1.68367 WP_000435132.1.6839 WP_000435132.1.68397 WP_000435132.1.68399 WP_000435132.1.68404 WP_000435132.1.68416 WP_000435132.1.68425 WP_000435132.1.68466 WP_000435132.1.68476 WP_000435132.1.68479 WP_000435132.1.68483 WP_000435132.1.68489 WP_000435132.1.68504 WP_000435132.1.68512 WP_000435132.1.68522 WP_000435132.1.68542 WP_000435132.1.68548 WP_000435132.1.68575 WP_000435132.1.686 WP_000435132.1.68650 WP_000435132.1.68657 WP_000435132.1.68683 WP_000435132.1.68699 WP_000435132.1.68703 WP_000435132.1.68716 WP_000435132.1.68728 WP_000435132.1.68737 WP_000435132.1.68741 WP_000435132.1.68743 WP_000435132.1.68775 WP_000435132.1.68813 WP_000435132.1.68831 WP_000435132.1.68854 WP_000435132.1.68875 WP_000435132.1.68878 WP_000435132.1.68883 WP_000435132.1.68917 WP_000435132.1.68943 WP_000435132.1.68944 WP_000435132.1.68987 WP_000435132.1.68988 WP_000435132.1.68998 WP_000435132.1.69045 WP_000435132.1.69071 WP_000435132.1.69078 WP_000435132.1.69087 WP_000435132.1.69089 WP_000435132.1.69110 WP_000435132.1.69111 WP_000435132.1.69120 WP_000435132.1.69125 WP_000435132.1.69147 WP_000435132.1.6915 WP_000435132.1.6917 WP_000435132.1.69179 WP_000435132.1.69191 WP_000435132.1.69198 WP_000435132.1.69213 WP_000435132.1.69219 WP_000435132.1.69222 WP_000435132.1.69237 WP_000435132.1.69239 WP_000435132.1.69251 WP_000435132.1.69266 WP_000435132.1.69280 WP_000435132.1.69314 WP_000435132.1.69349 WP_000435132.1.69366 WP_000435132.1.69378 WP_000435132.1.69394 WP_000435132.1.69395 WP_000435132.1.69409 WP_000435132.1.69415 WP_000435132.1.69434 WP_000435132.1.69437 WP_000435132.1.69446 WP_000435132.1.69475 WP_000435132.1.69476 WP_000435132.1.69477 WP_000435132.1.69480 WP_000435132.1.69484 WP_000435132.1.69490 WP_000435132.1.695 WP_000435132.1.69546 WP_000435132.1.69552 WP_000435132.1.69559 WP_000435132.1.69563 WP_000435132.1.69598 WP_000435132.1.69622 WP_000435132.1.69679 WP_000435132.1.6968 WP_000435132.1.69683 WP_000435132.1.69685 WP_000435132.1.69718 WP_000435132.1.69724 WP_000435132.1.69734 WP_000435132.1.6980 WP_000435132.1.69820 WP_000435132.1.69823 WP_000435132.1.69830 WP_000435132.1.69877 WP_000435132.1.69878 WP_000435132.1.69882 WP_000435132.1.699 WP_000435132.1.69902 WP_000435132.1.69921 WP_000435132.1.69934 WP_000435132.1.69980 WP_000435132.1.69987 WP_000435132.1.69995 WP_000435132.1.70024 WP_000435132.1.70048 WP_000435132.1.70059 WP_000435132.1.70089 WP_000435132.1.70094 WP_000435132.1.70105 WP_000435132.1.7012 WP_000435132.1.70133 WP_000435132.1.70161 WP_000435132.1.70220 WP_000435132.1.70225 WP_000435132.1.70228 WP_000435132.1.7024 WP_000435132.1.70253 WP_000435132.1.70273 WP_000435132.1.70294 WP_000435132.1.703 WP_000435132.1.7030 WP_000435132.1.70311 WP_000435132.1.70313 WP_000435132.1.70334 WP_000435132.1.70338 WP_000435132.1.7034 WP_000435132.1.70344 WP_000435132.1.70349 WP_000435132.1.70353 WP_000435132.1.70361 WP_000435132.1.70389 WP_000435132.1.70413 WP_000435132.1.7043 WP_000435132.1.70438 WP_000435132.1.70441 WP_000435132.1.70448 WP_000435132.1.70451 WP_000435132.1.70459 WP_000435132.1.70462 WP_000435132.1.70487 WP_000435132.1.70527 WP_000435132.1.7053 WP_000435132.1.70554 WP_000435132.1.70558 WP_000435132.1.70572 WP_000435132.1.706 WP_000435132.1.7061 WP_000435132.1.70635 WP_000435132.1.7064 WP_000435132.1.70641 WP_000435132.1.70651 WP_000435132.1.70664 WP_000435132.1.7067 WP_000435132.1.707 WP_000435132.1.7071 WP_000435132.1.70721 WP_000435132.1.7073 WP_000435132.1.70763 WP_000435132.1.70790 WP_000435132.1.70791 WP_000435132.1.70808 WP_000435132.1.70818 WP_000435132.1.70823 WP_000435132.1.70835 WP_000435132.1.70843 WP_000435132.1.7089 WP_000435132.1.70917 WP_000435132.1.70926 WP_000435132.1.70930 WP_000435132.1.70939 WP_000435132.1.70943 WP_000435132.1.710 WP_000435132.1.71016 WP_000435132.1.71043 WP_000435132.1.7105 WP_000435132.1.71058 WP_000435132.1.71059 WP_000435132.1.71073 WP_000435132.1.7109 WP_000435132.1.711 WP_000435132.1.71130 WP_000435132.1.71143 WP_000435132.1.71180 WP_000435132.1.71182 WP_000435132.1.7119 WP_000435132.1.71196 WP_000435132.1.7120 WP_000435132.1.71208 WP_000435132.1.71231 WP_000435132.1.7125 WP_000435132.1.71256 WP_000435132.1.71257 WP_000435132.1.71267 WP_000435132.1.71295 WP_000435132.1.71298 WP_000435132.1.71313 WP_000435132.1.71316 WP_000435132.1.71325 WP_000435132.1.71332 WP_000435132.1.71345 WP_000435132.1.71351 WP_000435132.1.71359 WP_000435132.1.71410 WP_000435132.1.71416 WP_000435132.1.71431 WP_000435132.1.71463 WP_000435132.1.71466 WP_000435132.1.71467 WP_000435132.1.7150 WP_000435132.1.71519 WP_000435132.1.71521 WP_000435132.1.71529 WP_000435132.1.71543 WP_000435132.1.71572 WP_000435132.1.71575 WP_000435132.1.7158 WP_000435132.1.71590 WP_000435132.1.71596 WP_000435132.1.71602 WP_000435132.1.7161 WP_000435132.1.7164 WP_000435132.1.71644 WP_000435132.1.71662 WP_000435132.1.71676 WP_000435132.1.71707 WP_000435132.1.71715 WP_000435132.1.71721 WP_000435132.1.71735 WP_000435132.1.71737 WP_000435132.1.71739 WP_000435132.1.71741 WP_000435132.1.71772 WP_000435132.1.71780 WP_000435132.1.71788 WP_000435132.1.7179 WP_000435132.1.71859 WP_000435132.1.71861 WP_000435132.1.71863 WP_000435132.1.71877 WP_000435132.1.71888 WP_000435132.1.71892 WP_000435132.1.71899 WP_000435132.1.71910 WP_000435132.1.71925 WP_000435132.1.7193 WP_000435132.1.71949 WP_000435132.1.71978 WP_000435132.1.7198 WP_000435132.1.71989 WP_000435132.1.72002 WP_000435132.1.72018 WP_000435132.1.72026 WP_000435132.1.72031 WP_000435132.1.72035 WP_000435132.1.72067 WP_000435132.1.72085 WP_000435132.1.72089 WP_000435132.1.72099 WP_000435132.1.72102 WP_000435132.1.72112 WP_000435132.1.72148 WP_000435132.1.72169 WP_000435132.1.722 WP_000435132.1.72204 WP_000435132.1.72205 WP_000435132.1.72224 WP_000435132.1.72271 WP_000435132.1.72285 WP_000435132.1.72306 WP_000435132.1.72330 WP_000435132.1.72340 WP_000435132.1.72347 WP_000435132.1.7236 WP_000435132.1.72363 WP_000435132.1.72366 WP_000435132.1.72371 WP_000435132.1.7242 WP_000435132.1.72424 WP_000435132.1.72433 WP_000435132.1.72446 WP_000435132.1.72453 WP_000435132.1.72465 WP_000435132.1.72478 WP_000435132.1.72496 WP_000435132.1.72497 WP_000435132.1.7254 WP_000435132.1.72547 WP_000435132.1.72564 WP_000435132.1.7258 WP_000435132.1.7260 WP_000435132.1.72626 WP_000435132.1.72649 WP_000435132.1.72654 WP_000435132.1.72666 WP_000435132.1.72708 WP_000435132.1.72719 WP_000435132.1.72753 WP_000435132.1.72762 WP_000435132.1.7278 WP_000435132.1.72787 WP_000435132.1.72832 WP_000435132.1.72834 WP_000435132.1.72835 WP_000435132.1.72881 WP_000435132.1.72903 WP_000435132.1.7292 WP_000435132.1.72930 WP_000435132.1.72935 WP_000435132.1.72945 WP_000435132.1.72961 WP_000435132.1.72965 WP_000435132.1.72991 WP_000435132.1.73002 WP_000435132.1.73004 WP_000435132.1.73017 WP_000435132.1.73019 WP_000435132.1.73021 WP_000435132.1.73022 WP_000435132.1.73037 WP_000435132.1.73046 WP_000435132.1.73074 WP_000435132.1.73087 WP_000435132.1.73121 WP_000435132.1.73122 WP_000435132.1.73132 WP_000435132.1.73140 WP_000435132.1.73190 WP_000435132.1.73191 WP_000435132.1.73195 WP_000435132.1.73201 WP_000435132.1.73211 WP_000435132.1.73246 WP_000435132.1.7326 WP_000435132.1.73264 WP_000435132.1.73265 WP_000435132.1.73286 WP_000435132.1.73312 WP_000435132.1.73386 WP_000435132.1.73401 WP_000435132.1.73420 WP_000435132.1.73444 WP_000435132.1.73450 WP_000435132.1.73456 WP_000435132.1.73464 WP_000435132.1.73467 WP_000435132.1.73501 WP_000435132.1.73513 WP_000435132.1.73526 WP_000435132.1.73539 WP_000435132.1.73571 WP_000435132.1.73591 WP_000435132.1.736 WP_000435132.1.7360 WP_000435132.1.73610 WP_000435132.1.73639 WP_000435132.1.73640 WP_000435132.1.7365 WP_000435132.1.73674 WP_000435132.1.73685 WP_000435132.1.73694 WP_000435132.1.73733 WP_000435132.1.73735 WP_000435132.1.73736 WP_000435132.1.73740 WP_000435132.1.73786 WP_000435132.1.73789 WP_000435132.1.7380 WP_000435132.1.73834 WP_000435132.1.73853 WP_000435132.1.73858 WP_000435132.1.73880 WP_000435132.1.73885 WP_000435132.1.73900 WP_000435132.1.73902 WP_000435132.1.73910 WP_000435132.1.73920 WP_000435132.1.73921 WP_000435132.1.73940 WP_000435132.1.73949 WP_000435132.1.73961 WP_000435132.1.73969 WP_000435132.1.73971 WP_000435132.1.73976 WP_000435132.1.73983 WP_000435132.1.74004 WP_000435132.1.74006 WP_000435132.1.7401 WP_000435132.1.74010 WP_000435132.1.74013 WP_000435132.1.7406 WP_000435132.1.74073 WP_000435132.1.74081 WP_000435132.1.74085 WP_000435132.1.74138 WP_000435132.1.74157 WP_000435132.1.74158 WP_000435132.1.74161 WP_000435132.1.74173 WP_000435132.1.7418 WP_000435132.1.74183 WP_000435132.1.74187 WP_000435132.1.74201 WP_000435132.1.74216 WP_000435132.1.74221 WP_000435132.1.74234 WP_000435132.1.74237 WP_000435132.1.74257 WP_000435132.1.74273 WP_000435132.1.7428 WP_000435132.1.74284 WP_000435132.1.74295 WP_000435132.1.74327 WP_000435132.1.74338 WP_000435132.1.7434 WP_000435132.1.74353 WP_000435132.1.74380 WP_000435132.1.74390 WP_000435132.1.74429 WP_000435132.1.74456 WP_000435132.1.74457 WP_000435132.1.74468 WP_000435132.1.74474 WP_000435132.1.74486 WP_000435132.1.74497 WP_000435132.1.74510 WP_000435132.1.74533 WP_000435132.1.74556 WP_000435132.1.7457 WP_000435132.1.74576 WP_000435132.1.74587 WP_000435132.1.74590 WP_000435132.1.74610 WP_000435132.1.74638 WP_000435132.1.74645 WP_000435132.1.74676 WP_000435132.1.74681 WP_000435132.1.74696 WP_000435132.1.74704 WP_000435132.1.74731 WP_000435132.1.74747 WP_000435132.1.74758 WP_000435132.1.74761 WP_000435132.1.74770 WP_000435132.1.74781 WP_000435132.1.74785 WP_000435132.1.74797 WP_000435132.1.74802 WP_000435132.1.74808 WP_000435132.1.7482 WP_000435132.1.74840 WP_000435132.1.74846 WP_000435132.1.74849 WP_000435132.1.74866 WP_000435132.1.74874 WP_000435132.1.74890 WP_000435132.1.74899 WP_000435132.1.74911 WP_000435132.1.74922 WP_000435132.1.74961 WP_000435132.1.74963 WP_000435132.1.74994 WP_000435132.1.74999 WP_000435132.1.7500 WP_000435132.1.75006 WP_000435132.1.75038 WP_000435132.1.75044 WP_000435132.1.75048 WP_000435132.1.75052 WP_000435132.1.75070 WP_000435132.1.75091 WP_000435132.1.75111 WP_000435132.1.75122 WP_000435132.1.75131 WP_000435132.1.75132 WP_000435132.1.75186 WP_000435132.1.75227 WP_000435132.1.75252 WP_000435132.1.75253 WP_000435132.1.75294 WP_000435132.1.75298 WP_000435132.1.75304 WP_000435132.1.75320 WP_000435132.1.75323 WP_000435132.1.75327 WP_000435132.1.75351 WP_000435132.1.75356 WP_000435132.1.75365 WP_000435132.1.75369 WP_000435132.1.75375 WP_000435132.1.75399 WP_000435132.1.75409 WP_000435132.1.75411 WP_000435132.1.7542 WP_000435132.1.75438 WP_000435132.1.75440 WP_000435132.1.75481 WP_000435132.1.75506 WP_000435132.1.75509 WP_000435132.1.75527 WP_000435132.1.75538 WP_000435132.1.75542 WP_000435132.1.75551 WP_000435132.1.75566 WP_000435132.1.7561 WP_000435132.1.75623 WP_000435132.1.75647 WP_000435132.1.75649 WP_000435132.1.75652 WP_000435132.1.75680 WP_000435132.1.75685 WP_000435132.1.75692 WP_000435132.1.75743 WP_000435132.1.75769 WP_000435132.1.75770 WP_000435132.1.75775 WP_000435132.1.758 WP_000435132.1.75800 WP_000435132.1.75809 WP_000435132.1.75824 WP_000435132.1.75830 WP_000435132.1.7584 WP_000435132.1.75840 WP_000435132.1.75848 WP_000435132.1.75851 WP_000435132.1.75856 WP_000435132.1.75862 WP_000435132.1.75879 WP_000435132.1.75881 WP_000435132.1.75885 WP_000435132.1.75910 WP_000435132.1.75929 WP_000435132.1.75952 WP_000435132.1.75956 WP_000435132.1.7596 WP_000435132.1.75969 WP_000435132.1.76010 WP_000435132.1.76013 WP_000435132.1.76015 WP_000435132.1.7602 WP_000435132.1.76047 WP_000435132.1.76049 WP_000435132.1.76050 WP_000435132.1.76053 WP_000435132.1.76071 WP_000435132.1.76073 WP_000435132.1.76095 WP_000435132.1.76111 WP_000435132.1.76112 WP_000435132.1.76114 WP_000435132.1.76121 WP_000435132.1.76136 WP_000435132.1.76143 WP_000435132.1.76149 WP_000435132.1.76153 WP_000435132.1.76179 WP_000435132.1.76185 WP_000435132.1.76230 WP_000435132.1.76234 WP_000435132.1.7624 WP_000435132.1.7625 WP_000435132.1.76258 WP_000435132.1.76261 WP_000435132.1.7627 WP_000435132.1.76283 WP_000435132.1.76294 WP_000435132.1.76295 WP_000435132.1.76323 WP_000435132.1.76332 WP_000435132.1.76333 WP_000435132.1.76337 WP_000435132.1.76351 WP_000435132.1.7638 WP_000435132.1.76419 WP_000435132.1.76420 WP_000435132.1.76421 WP_000435132.1.76424 WP_000435132.1.76426 WP_000435132.1.76431 WP_000435132.1.76463 WP_000435132.1.76482 WP_000435132.1.76497 WP_000435132.1.76604 WP_000435132.1.76606 WP_000435132.1.76624 WP_000435132.1.76648 WP_000435132.1.76674 WP_000435132.1.76686 WP_000435132.1.76690 WP_000435132.1.76693 WP_000435132.1.76711 WP_000435132.1.76718 WP_000435132.1.7675 WP_000435132.1.76790 WP_000435132.1.76792 WP_000435132.1.76798 WP_000435132.1.768 WP_000435132.1.76803 WP_000435132.1.76816 WP_000435132.1.76820 WP_000435132.1.76825 WP_000435132.1.76829 WP_000435132.1.76839 WP_000435132.1.76845 WP_000435132.1.7686 WP_000435132.1.76867 WP_000435132.1.76872 WP_000435132.1.76876 WP_000435132.1.76897 WP_000435132.1.76920 WP_000435132.1.76921 WP_000435132.1.76937 WP_000435132.1.7694 WP_000435132.1.76944 WP_000435132.1.76952 WP_000435132.1.76998 WP_000435132.1.77013 WP_000435132.1.77027 WP_000435132.1.77041 WP_000435132.1.77043 WP_000435132.1.77050 WP_000435132.1.77060 WP_000435132.1.77062 WP_000435132.1.77069 WP_000435132.1.77072 WP_000435132.1.77112 WP_000435132.1.77137 WP_000435132.1.77145 WP_000435132.1.77158 WP_000435132.1.77176 WP_000435132.1.77183 WP_000435132.1.77187 WP_000435132.1.77203 WP_000435132.1.77229 WP_000435132.1.77259 WP_000435132.1.77297 WP_000435132.1.77298 WP_000435132.1.77305 WP_000435132.1.77315 WP_000435132.1.77346 WP_000435132.1.77354 WP_000435132.1.77359 WP_000435132.1.77388 WP_000435132.1.77416 WP_000435132.1.77426 WP_000435132.1.77446 WP_000435132.1.7745 WP_000435132.1.7746 WP_000435132.1.77460 WP_000435132.1.77485 WP_000435132.1.77489 WP_000435132.1.77497 WP_000435132.1.77498 WP_000435132.1.77520 WP_000435132.1.77527 WP_000435132.1.77532 WP_000435132.1.77533 WP_000435132.1.77536 WP_000435132.1.77572 WP_000435132.1.77603 WP_000435132.1.77606 WP_000435132.1.77650 WP_000435132.1.77674 WP_000435132.1.77733 WP_000435132.1.77735 WP_000435132.1.77738 WP_000435132.1.77743 WP_000435132.1.77745 WP_000435132.1.77791 WP_000435132.1.77805 WP_000435132.1.77814 WP_000435132.1.77818 WP_000435132.1.77822 WP_000435132.1.77827 WP_000435132.1.77832 WP_000435132.1.77848 WP_000435132.1.7785 WP_000435132.1.77858 WP_000435132.1.7786 WP_000435132.1.7787 WP_000435132.1.77882 WP_000435132.1.77893 WP_000435132.1.77896 WP_000435132.1.77908 WP_000435132.1.77915 WP_000435132.1.77922 WP_000435132.1.77930 WP_000435132.1.77952 WP_000435132.1.77957 WP_000435132.1.77986 WP_000435132.1.78002 WP_000435132.1.78038 WP_000435132.1.78050 WP_000435132.1.78054 WP_000435132.1.78067 WP_000435132.1.78082 WP_000435132.1.78091 WP_000435132.1.78093 WP_000435132.1.78116 WP_000435132.1.78126 WP_000435132.1.78164 WP_000435132.1.78173 WP_000435132.1.78179 WP_000435132.1.78185 WP_000435132.1.78189 WP_000435132.1.78194 WP_000435132.1.78207 WP_000435132.1.78210 WP_000435132.1.78252 WP_000435132.1.78254 WP_000435132.1.78257 WP_000435132.1.78304 WP_000435132.1.78330 WP_000435132.1.78332 WP_000435132.1.78365 WP_000435132.1.78371 WP_000435132.1.78404 WP_000435132.1.78434 WP_000435132.1.78436 WP_000435132.1.78458 WP_000435132.1.78470 WP_000435132.1.78478 WP_000435132.1.78489 WP_000435132.1.78494 WP_000435132.1.7850 WP_000435132.1.78513 WP_000435132.1.7853 WP_000435132.1.78550 WP_000435132.1.78558 WP_000435132.1.7857 WP_000435132.1.78573 WP_000435132.1.78582 WP_000435132.1.78585 WP_000435132.1.78592 WP_000435132.1.78596 WP_000435132.1.78598 WP_000435132.1.78604 WP_000435132.1.78625 WP_000435132.1.78633 WP_000435132.1.78653 WP_000435132.1.78662 WP_000435132.1.78667 WP_000435132.1.7868 WP_000435132.1.78685 WP_000435132.1.78728 WP_000435132.1.78731 WP_000435132.1.78736 WP_000435132.1.78758 WP_000435132.1.78763 WP_000435132.1.78803 WP_000435132.1.78816 WP_000435132.1.78819 WP_000435132.1.78841 WP_000435132.1.78872 WP_000435132.1.7888 WP_000435132.1.78897 WP_000435132.1.78920 WP_000435132.1.78934 WP_000435132.1.78937 WP_000435132.1.78946 WP_000435132.1.78983 WP_000435132.1.78991 WP_000435132.1.78995 WP_000435132.1.7900 WP_000435132.1.79006 WP_000435132.1.79037 WP_000435132.1.79038 WP_000435132.1.7905 WP_000435132.1.79051 WP_000435132.1.79085 WP_000435132.1.79114 WP_000435132.1.79131 WP_000435132.1.79132 WP_000435132.1.7914 WP_000435132.1.79170 WP_000435132.1.79178 WP_000435132.1.79192 WP_000435132.1.79197 WP_000435132.1.79208 WP_000435132.1.79223 WP_000435132.1.79227 WP_000435132.1.79270 WP_000435132.1.79275 WP_000435132.1.79285 WP_000435132.1.7930 WP_000435132.1.7931 WP_000435132.1.79310 WP_000435132.1.79314 WP_000435132.1.79322 WP_000435132.1.79332 WP_000435132.1.79334 WP_000435132.1.7934 WP_000435132.1.79367 WP_000435132.1.79374 WP_000435132.1.79379 WP_000435132.1.79402 WP_000435132.1.79407 WP_000435132.1.79436 WP_000435132.1.79461 WP_000435132.1.79473 WP_000435132.1.79476 WP_000435132.1.79487 WP_000435132.1.79539 WP_000435132.1.79543 WP_000435132.1.79552 WP_000435132.1.79554 WP_000435132.1.79556 WP_000435132.1.79566 WP_000435132.1.79581 WP_000435132.1.79626 WP_000435132.1.79627 WP_000435132.1.79638 WP_000435132.1.79646 WP_000435132.1.79662 WP_000435132.1.79672 WP_000435132.1.79677 WP_000435132.1.79706 WP_000435132.1.79731 WP_000435132.1.79763 WP_000435132.1.7981 WP_000435132.1.79810 WP_000435132.1.79815 WP_000435132.1.79822 WP_000435132.1.79831 WP_000435132.1.79834 WP_000435132.1.79837 WP_000435132.1.7989 WP_000435132.1.79896 WP_000435132.1.79904 WP_000435132.1.79911 WP_000435132.1.79919 WP_000435132.1.7992 WP_000435132.1.79941 WP_000435132.1.79949 WP_000435132.1.79961 WP_000435132.1.79971 WP_000435132.1.79991 WP_000435132.1.80000 WP_000435132.1.80009 WP_000435132.1.80013 WP_000435132.1.80029 WP_000435132.1.80032 WP_000435132.1.80034 WP_000435132.1.80042 WP_000435132.1.80079 WP_000435132.1.80086 WP_000435132.1.80109 WP_000435132.1.80119 WP_000435132.1.80120 WP_000435132.1.80122 WP_000435132.1.80124 WP_000435132.1.80127 WP_000435132.1.80146 WP_000435132.1.80147 WP_000435132.1.80159 WP_000435132.1.80178 WP_000435132.1.80184 WP_000435132.1.80193 WP_000435132.1.80203 WP_000435132.1.80206 WP_000435132.1.80210 WP_000435132.1.80244 WP_000435132.1.80274 WP_000435132.1.80287 WP_000435132.1.80290 WP_000435132.1.80303 WP_000435132.1.80308 WP_000435132.1.8031 WP_000435132.1.80316 WP_000435132.1.80318 WP_000435132.1.80345 WP_000435132.1.8035 WP_000435132.1.80358 WP_000435132.1.80361 WP_000435132.1.80378 WP_000435132.1.80389 WP_000435132.1.8040 WP_000435132.1.8043 WP_000435132.1.80430 WP_000435132.1.80434 WP_000435132.1.8045 WP_000435132.1.80472 WP_000435132.1.80482 WP_000435132.1.80521 WP_000435132.1.80530 WP_000435132.1.80582 WP_000435132.1.8065 WP_000435132.1.80653 WP_000435132.1.8066 WP_000435132.1.80680 WP_000435132.1.80687 WP_000435132.1.80717 WP_000435132.1.80745 WP_000435132.1.80761 WP_000435132.1.80763 WP_000435132.1.80781 WP_000435132.1.80793 WP_000435132.1.80801 WP_000435132.1.80828 WP_000435132.1.80833 WP_000435132.1.8084 WP_000435132.1.8085 WP_000435132.1.80855 WP_000435132.1.80872 WP_000435132.1.80899 WP_000435132.1.809 WP_000435132.1.80962 WP_000435132.1.80979 WP_000435132.1.80980 WP_000435132.1.81010 WP_000435132.1.81049 WP_000435132.1.81052 WP_000435132.1.81055 WP_000435132.1.81064 WP_000435132.1.81065 WP_000435132.1.81085 WP_000435132.1.81092 WP_000435132.1.81095 WP_000435132.1.81097 WP_000435132.1.81114 WP_000435132.1.81132 WP_000435132.1.81151 WP_000435132.1.81157 WP_000435132.1.81171 WP_000435132.1.81172 WP_000435132.1.81176 WP_000435132.1.81184 WP_000435132.1.81214 WP_000435132.1.81228 WP_000435132.1.81232 WP_000435132.1.81234 WP_000435132.1.81252 WP_000435132.1.81288 WP_000435132.1.81344 WP_000435132.1.8135 WP_000435132.1.81384 WP_000435132.1.81385 WP_000435132.1.81389 WP_000435132.1.8142 WP_000435132.1.81436 WP_000435132.1.8144 WP_000435132.1.81464 WP_000435132.1.81467 WP_000435132.1.81508 WP_000435132.1.81522 WP_000435132.1.81549 WP_000435132.1.81572 WP_000435132.1.81574 WP_000435132.1.81599 WP_000435132.1.8160 WP_000435132.1.81604 WP_000435132.1.81610 WP_000435132.1.81619 WP_000435132.1.81631 WP_000435132.1.81637 WP_000435132.1.81645 WP_000435132.1.81651 WP_000435132.1.81734 WP_000435132.1.81740 WP_000435132.1.81758 WP_000435132.1.8176 WP_000435132.1.81767 WP_000435132.1.8180 WP_000435132.1.81800 WP_000435132.1.81810 WP_000435132.1.81812 WP_000435132.1.81831 WP_000435132.1.81837 WP_000435132.1.81838 WP_000435132.1.81847 WP_000435132.1.8185 WP_000435132.1.81861 WP_000435132.1.81870 WP_000435132.1.8188 WP_000435132.1.81897 WP_000435132.1.81903 WP_000435132.1.81904 WP_000435132.1.81905 WP_000435132.1.81906 WP_000435132.1.81919 WP_000435132.1.81940 WP_000435132.1.81944 WP_000435132.1.81955 WP_000435132.1.81969 WP_000435132.1.81990 WP_000435132.1.81996 WP_000435132.1.82009 WP_000435132.1.82015 WP_000435132.1.82026 WP_000435132.1.82053 WP_000435132.1.82058 WP_000435132.1.8206 WP_000435132.1.82100 WP_000435132.1.82103 WP_000435132.1.8212 WP_000435132.1.82121 WP_000435132.1.8213 WP_000435132.1.82161 WP_000435132.1.82167 WP_000435132.1.82174 WP_000435132.1.82184 WP_000435132.1.82219 WP_000435132.1.82247 WP_000435132.1.82253 WP_000435132.1.82259 WP_000435132.1.82278 WP_000435132.1.82281 WP_000435132.1.82301 WP_000435132.1.82321 WP_000435132.1.82340 WP_000435132.1.82349 WP_000435132.1.82354 WP_000435132.1.82358 WP_000435132.1.82368 WP_000435132.1.82406 WP_000435132.1.8244 WP_000435132.1.82441 WP_000435132.1.82447 WP_000435132.1.82458 WP_000435132.1.82468 WP_000435132.1.82472 WP_000435132.1.82525 WP_000435132.1.82535 WP_000435132.1.82548 WP_000435132.1.82558 WP_000435132.1.82612 WP_000435132.1.8265 WP_000435132.1.8266 WP_000435132.1.82665 WP_000435132.1.82678 WP_000435132.1.82709 WP_000435132.1.82724 WP_000435132.1.82760 WP_000435132.1.82762 WP_000435132.1.82768 WP_000435132.1.82775 WP_000435132.1.82796 WP_000435132.1.8280 WP_000435132.1.82802 WP_000435132.1.82824 WP_000435132.1.82829 WP_000435132.1.82835 WP_000435132.1.82855 WP_000435132.1.82862 WP_000435132.1.8289 WP_000435132.1.82916 WP_000435132.1.82930 WP_000435132.1.82931 WP_000435132.1.82941 WP_000435132.1.82976 WP_000435132.1.82980 WP_000435132.1.82984 WP_000435132.1.82997 WP_000435132.1.82999 WP_000435132.1.83011 WP_000435132.1.83013 WP_000435132.1.83046 WP_000435132.1.83050 WP_000435132.1.83053 WP_000435132.1.83054 WP_000435132.1.83066 WP_000435132.1.83078 WP_000435132.1.83086 WP_000435132.1.8310 WP_000435132.1.83103 WP_000435132.1.83152 WP_000435132.1.83153 WP_000435132.1.8318 WP_000435132.1.83185 WP_000435132.1.83193 WP_000435132.1.83203 WP_000435132.1.83234 WP_000435132.1.83243 WP_000435132.1.8328 WP_000435132.1.83291 WP_000435132.1.83314 WP_000435132.1.83316 WP_000435132.1.83352 WP_000435132.1.83359 WP_000435132.1.83372 WP_000435132.1.83405 WP_000435132.1.83416 WP_000435132.1.83417 WP_000435132.1.83418 WP_000435132.1.8346 WP_000435132.1.83467 WP_000435132.1.83468 WP_000435132.1.83472 WP_000435132.1.83475 WP_000435132.1.83476 WP_000435132.1.83479 WP_000435132.1.83484 WP_000435132.1.83508 WP_000435132.1.83517 WP_000435132.1.83520 WP_000435132.1.83541 WP_000435132.1.83553 WP_000435132.1.83592 WP_000435132.1.83593 WP_000435132.1.83626 WP_000435132.1.83645 WP_000435132.1.83646 WP_000435132.1.83652 WP_000435132.1.83653 WP_000435132.1.8366 WP_000435132.1.83674 WP_000435132.1.83676 WP_000435132.1.83714 WP_000435132.1.83720 WP_000435132.1.83728 WP_000435132.1.83756 WP_000435132.1.83758 WP_000435132.1.83763 WP_000435132.1.83769 WP_000435132.1.83775 WP_000435132.1.83778 WP_000435132.1.83788 WP_000435132.1.83797 WP_000435132.1.83804 WP_000435132.1.83825 WP_000435132.1.8383 WP_000435132.1.83837 WP_000435132.1.83844 WP_000435132.1.8385 WP_000435132.1.83852 WP_000435132.1.83868 WP_000435132.1.83881 WP_000435132.1.83886 WP_000435132.1.83902 WP_000435132.1.83912 WP_000435132.1.83917 WP_000435132.1.83919 WP_000435132.1.83925 WP_000435132.1.83928 WP_000435132.1.83935 WP_000435132.1.83955 WP_000435132.1.83980 WP_000435132.1.83984 WP_000435132.1.83989 WP_000435132.1.84010 WP_000435132.1.84025 WP_000435132.1.84041 WP_000435132.1.84049 WP_000435132.1.84054 WP_000435132.1.84064 WP_000435132.1.84067 WP_000435132.1.84068 WP_000435132.1.84118 WP_000435132.1.84144 WP_000435132.1.84161 WP_000435132.1.84163 WP_000435132.1.84188 WP_000435132.1.84284 WP_000435132.1.84293 WP_000435132.1.84322 WP_000435132.1.84414 WP_000435132.1.84415 WP_000435132.1.84416 WP_000435132.1.84418 WP_000435132.1.84442 WP_000435132.1.84445 WP_000435132.1.84451 WP_000435132.1.84509 WP_000435132.1.84555 WP_000435132.1.84563 WP_000435132.1.84570 WP_000435132.1.84578 WP_000435132.1.84590 WP_000435132.1.84596 WP_000435132.1.84602 WP_000435132.1.84608 WP_000435132.1.84612 WP_000435132.1.8462 WP_000435132.1.84625 WP_000435132.1.84630 WP_000435132.1.84638 WP_000435132.1.84648 WP_000435132.1.84651 WP_000435132.1.84652 WP_000435132.1.84662 WP_000435132.1.8468 WP_000435132.1.84682 WP_000435132.1.84696 WP_000435132.1.84700 WP_000435132.1.8475 WP_000435132.1.84752 WP_000435132.1.84757 WP_000435132.1.84761 WP_000435132.1.84770 WP_000435132.1.84815 WP_000435132.1.84826 WP_000435132.1.84847 WP_000435132.1.84854 WP_000435132.1.84889 WP_000435132.1.84903 WP_000435132.1.84907 WP_000435132.1.84924 WP_000435132.1.8493 WP_000435132.1.8496 WP_000435132.1.84975 WP_000435132.1.84978 WP_000435132.1.85017 WP_000435132.1.85022 WP_000435132.1.85026 WP_000435132.1.85045 WP_000435132.1.85047 WP_000435132.1.85056 WP_000435132.1.85070 WP_000435132.1.85081 WP_000435132.1.85083 WP_000435132.1.85099 WP_000435132.1.851 WP_000435132.1.85113 WP_000435132.1.85118 WP_000435132.1.85132 WP_000435132.1.85135 WP_000435132.1.85144 WP_000435132.1.85151 WP_000435132.1.85160 WP_000435132.1.85173 WP_000435132.1.85213 WP_000435132.1.85224 WP_000435132.1.85226 WP_000435132.1.85229 WP_000435132.1.85231 WP_000435132.1.85235 WP_000435132.1.85238 WP_000435132.1.85289 WP_000435132.1.85292 WP_000435132.1.85294 WP_000435132.1.85297 WP_000435132.1.85351 WP_000435132.1.85374 WP_000435132.1.85375 WP_000435132.1.85376 WP_000435132.1.85383 WP_000435132.1.85395 WP_000435132.1.85404 WP_000435132.1.85441 WP_000435132.1.85445 WP_000435132.1.85455 WP_000435132.1.85462 WP_000435132.1.85471 WP_000435132.1.85474 WP_000435132.1.85485 WP_000435132.1.85492 WP_000435132.1.85506 WP_000435132.1.8551 WP_000435132.1.85515 WP_000435132.1.85519 WP_000435132.1.85542 WP_000435132.1.85547 WP_000435132.1.85555 WP_000435132.1.85585 WP_000435132.1.85586 WP_000435132.1.85607 WP_000435132.1.85611 WP_000435132.1.85649 WP_000435132.1.85678 WP_000435132.1.85705 WP_000435132.1.85730 WP_000435132.1.85732 WP_000435132.1.85758 WP_000435132.1.85795 WP_000435132.1.85796 WP_000435132.1.85809 WP_000435132.1.85816 WP_000435132.1.85825 WP_000435132.1.85834 WP_000435132.1.85844 WP_000435132.1.85858 WP_000435132.1.85873 WP_000435132.1.85906 WP_000435132.1.85924 WP_000435132.1.85927 WP_000435132.1.85950 WP_000435132.1.85971 WP_000435132.1.85980 WP_000435132.1.85993 WP_000435132.1.86018 WP_000435132.1.86036 WP_000435132.1.86042 WP_000435132.1.86072 WP_000435132.1.86086 WP_000435132.1.86101 WP_000435132.1.86106 WP_000435132.1.86123 WP_000435132.1.86144 WP_000435132.1.86154 WP_000435132.1.86158 WP_000435132.1.8617 WP_000435132.1.86178 WP_000435132.1.86188 WP_000435132.1.862 WP_000435132.1.86207 WP_000435132.1.86209 WP_000435132.1.86241 WP_000435132.1.86248 WP_000435132.1.86256 WP_000435132.1.8627 WP_000435132.1.86270 WP_000435132.1.86281 WP_000435132.1.86304 WP_000435132.1.86315 WP_000435132.1.86344 WP_000435132.1.8636 WP_000435132.1.86363 WP_000435132.1.86367 WP_000435132.1.86378 WP_000435132.1.86390 WP_000435132.1.8643 WP_000435132.1.86439 WP_000435132.1.86473 WP_000435132.1.86482 WP_000435132.1.86505 WP_000435132.1.86523 WP_000435132.1.86531 WP_000435132.1.86542 WP_000435132.1.86606 WP_000435132.1.86628 WP_000435132.1.86629 WP_000435132.1.86664 WP_000435132.1.86704 WP_000435132.1.86706 WP_000435132.1.86736 WP_000435132.1.86745 WP_000435132.1.86754 WP_000435132.1.86779 WP_000435132.1.86792 WP_000435132.1.86793 WP_000435132.1.86795 WP_000435132.1.8681 WP_000435132.1.86881 WP_000435132.1.8690 WP_000435132.1.86911 WP_000435132.1.86940 WP_000435132.1.86955 WP_000435132.1.86961 WP_000435132.1.86968 WP_000435132.1.86977 WP_000435132.1.86999 WP_000435132.1.87021 WP_000435132.1.87022 WP_000435132.1.87042 WP_000435132.1.87057 WP_000435132.1.87072 WP_000435132.1.87088 WP_000435132.1.87090 WP_000435132.1.87096 WP_000435132.1.87097 WP_000435132.1.87100 WP_000435132.1.87110 WP_000435132.1.87119 WP_000435132.1.87122 WP_000435132.1.87133 WP_000435132.1.87137 WP_000435132.1.87141 WP_000435132.1.87168 WP_000435132.1.87175 WP_000435132.1.87190 WP_000435132.1.87194 WP_000435132.1.8720 WP_000435132.1.87204 WP_000435132.1.87221 WP_000435132.1.87250 WP_000435132.1.87260 WP_000435132.1.87263 WP_000435132.1.87272 WP_000435132.1.87285 WP_000435132.1.87290 WP_000435132.1.87296 WP_000435132.1.8731 WP_000435132.1.87363 WP_000435132.1.87372 WP_000435132.1.87378 WP_000435132.1.87388 WP_000435132.1.87391 WP_000435132.1.87396 WP_000435132.1.87397 WP_000435132.1.87425 WP_000435132.1.87434 WP_000435132.1.87457 WP_000435132.1.87461 WP_000435132.1.87466 WP_000435132.1.87475 WP_000435132.1.87486 WP_000435132.1.87497 WP_000435132.1.87498 WP_000435132.1.875 WP_000435132.1.87502 WP_000435132.1.87508 WP_000435132.1.87511 WP_000435132.1.87515 WP_000435132.1.8753 WP_000435132.1.87543 WP_000435132.1.8757 WP_000435132.1.87579 WP_000435132.1.87595 WP_000435132.1.87623 WP_000435132.1.8764 WP_000435132.1.87647 WP_000435132.1.87710 WP_000435132.1.87718 WP_000435132.1.87735 WP_000435132.1.87740 WP_000435132.1.87745 WP_000435132.1.87748 WP_000435132.1.87764 WP_000435132.1.8779 WP_000435132.1.87802 WP_000435132.1.87808 WP_000435132.1.87828 WP_000435132.1.87841 WP_000435132.1.87843 WP_000435132.1.87854 WP_000435132.1.87865 WP_000435132.1.87879 WP_000435132.1.87912 WP_000435132.1.87937 WP_000435132.1.87943 WP_000435132.1.87948 WP_000435132.1.87963 WP_000435132.1.87967 WP_000435132.1.87972 WP_000435132.1.87985 WP_000435132.1.87995 WP_000435132.1.88013 WP_000435132.1.88032 WP_000435132.1.88061 WP_000435132.1.88101 WP_000435132.1.88114 WP_000435132.1.88150 WP_000435132.1.88166 WP_000435132.1.88169 WP_000435132.1.8820 WP_000435132.1.88240 WP_000435132.1.88270 WP_000435132.1.88279 WP_000435132.1.88309 WP_000435132.1.88311 WP_000435132.1.88317 WP_000435132.1.88319 WP_000435132.1.88328 WP_000435132.1.88348 WP_000435132.1.88351 WP_000435132.1.88367 WP_000435132.1.88371 WP_000435132.1.88375 WP_000435132.1.88395 WP_000435132.1.88418 WP_000435132.1.88430 WP_000435132.1.88440 WP_000435132.1.88449 WP_000435132.1.88455 WP_000435132.1.8847 WP_000435132.1.88471 WP_000435132.1.88473 WP_000435132.1.88478 WP_000435132.1.88480 WP_000435132.1.88490 WP_000435132.1.88498 WP_000435132.1.88518 WP_000435132.1.88536 WP_000435132.1.88558 WP_000435132.1.88560 WP_000435132.1.88563 WP_000435132.1.8857 WP_000435132.1.88580 WP_000435132.1.88583 WP_000435132.1.88585 WP_000435132.1.8859 WP_000435132.1.88599 WP_000435132.1.88600 WP_000435132.1.88614 WP_000435132.1.88623 WP_000435132.1.88636 WP_000435132.1.88671 WP_000435132.1.88694 WP_000435132.1.8872 WP_000435132.1.88738 WP_000435132.1.88739 WP_000435132.1.88753 WP_000435132.1.88761 WP_000435132.1.88771 WP_000435132.1.88781 WP_000435132.1.88805 WP_000435132.1.88827 WP_000435132.1.88843 WP_000435132.1.88856 WP_000435132.1.88861 WP_000435132.1.88871 WP_000435132.1.88874 WP_000435132.1.88878 WP_000435132.1.8888 WP_000435132.1.88912 WP_000435132.1.88922 WP_000435132.1.88934 WP_000435132.1.88954 WP_000435132.1.88959 WP_000435132.1.88960 WP_000435132.1.88962 WP_000435132.1.88987 WP_000435132.1.8900 WP_000435132.1.89012 WP_000435132.1.89024 WP_000435132.1.89036 WP_000435132.1.8904 WP_000435132.1.89086 WP_000435132.1.89103 WP_000435132.1.89125 WP_000435132.1.8913 WP_000435132.1.89164 WP_000435132.1.89173 WP_000435132.1.8918 WP_000435132.1.89181 WP_000435132.1.89184 WP_000435132.1.89194 WP_000435132.1.89195 WP_000435132.1.89229 WP_000435132.1.89237 WP_000435132.1.8924 WP_000435132.1.89258 WP_000435132.1.89262 WP_000435132.1.89284 WP_000435132.1.89290 WP_000435132.1.89347 WP_000435132.1.89348 WP_000435132.1.89350 WP_000435132.1.89390 WP_000435132.1.89404 WP_000435132.1.89414 WP_000435132.1.89433 WP_000435132.1.89439 WP_000435132.1.8953 WP_000435132.1.89537 WP_000435132.1.89544 WP_000435132.1.89545 WP_000435132.1.89559 WP_000435132.1.89628 WP_000435132.1.89651 WP_000435132.1.89655 WP_000435132.1.89678 WP_000435132.1.897 WP_000435132.1.89715 WP_000435132.1.89726 WP_000435132.1.89730 WP_000435132.1.89738 WP_000435132.1.89754 WP_000435132.1.89779 WP_000435132.1.89794 WP_000435132.1.898 WP_000435132.1.89857 WP_000435132.1.8986 WP_000435132.1.89860 WP_000435132.1.89863 WP_000435132.1.89874 WP_000435132.1.89883 WP_000435132.1.8990 WP_000435132.1.89908 WP_000435132.1.89935 WP_000435132.1.89949 WP_000435132.1.89950 WP_000435132.1.89960 WP_000435132.1.90005 WP_000435132.1.90018 WP_000435132.1.90046 WP_000435132.1.90055 WP_000435132.1.90069 WP_000435132.1.90091 WP_000435132.1.90131 WP_000435132.1.90148 WP_000435132.1.90161 WP_000435132.1.90173 WP_000435132.1.90174 WP_000435132.1.90180 WP_000435132.1.90215 WP_000435132.1.9022 WP_000435132.1.90239 WP_000435132.1.90243 WP_000435132.1.90244 WP_000435132.1.90246 WP_000435132.1.90250 WP_000435132.1.90253 WP_000435132.1.90269 WP_000435132.1.90276 WP_000435132.1.9030 WP_000435132.1.90307 WP_000435132.1.90331 WP_000435132.1.90386 WP_000435132.1.90447 WP_000435132.1.90454 WP_000435132.1.90473 WP_000435132.1.90475 WP_000435132.1.90488 WP_000435132.1.90506 WP_000435132.1.90514 WP_000435132.1.90517 WP_000435132.1.90533 WP_000435132.1.90544 WP_000435132.1.90548 WP_000435132.1.9055 WP_000435132.1.90554 WP_000435132.1.90556 WP_000435132.1.90562 WP_000435132.1.90604 WP_000435132.1.90647 WP_000435132.1.90660 WP_000435132.1.90661 WP_000435132.1.90683 WP_000435132.1.90698 WP_000435132.1.9071 WP_000435132.1.90726 WP_000435132.1.90728 WP_000435132.1.90738 WP_000435132.1.9074 WP_000435132.1.90745 WP_000435132.1.9076 WP_000435132.1.90801 WP_000435132.1.90804 WP_000435132.1.90861 WP_000435132.1.90875 WP_000435132.1.90887 WP_000435132.1.90896 WP_000435132.1.90903 WP_000435132.1.90923 WP_000435132.1.90928 WP_000435132.1.90994 WP_000435132.1.9100 WP_000435132.1.91005 WP_000435132.1.91011 WP_000435132.1.91019 WP_000435132.1.91054 WP_000435132.1.91089 WP_000435132.1.91126 WP_000435132.1.9114 WP_000435132.1.91150 WP_000435132.1.91158 WP_000435132.1.91177 WP_000435132.1.912 WP_000435132.1.9122 WP_000435132.1.91233 WP_000435132.1.91246 WP_000435132.1.91258 WP_000435132.1.9127 WP_000435132.1.91279 WP_000435132.1.91280 WP_000435132.1.91287 WP_000435132.1.9130 WP_000435132.1.91300 WP_000435132.1.91310 WP_000435132.1.91316 WP_000435132.1.91332 WP_000435132.1.91346 WP_000435132.1.91357 WP_000435132.1.91364 WP_000435132.1.91371 WP_000435132.1.91380 WP_000435132.1.91382 WP_000435132.1.9140 WP_000435132.1.91420 WP_000435132.1.91427 WP_000435132.1.91447 WP_000435132.1.91465 WP_000435132.1.91486 WP_000435132.1.91487 WP_000435132.1.91500 WP_000435132.1.91501 WP_000435132.1.91525 WP_000435132.1.91530 WP_000435132.1.91542 WP_000435132.1.91547 WP_000435132.1.9155 WP_000435132.1.91559 WP_000435132.1.91573 WP_000435132.1.91581 WP_000435132.1.91586 WP_000435132.1.91587 WP_000435132.1.91591 WP_000435132.1.91611 WP_000435132.1.91629 WP_000435132.1.91634 WP_000435132.1.91635 WP_000435132.1.91639 WP_000435132.1.91670 WP_000435132.1.917 WP_000435132.1.91704 WP_000435132.1.91745 WP_000435132.1.91749 WP_000435132.1.91771 WP_000435132.1.91781 WP_000435132.1.91791 WP_000435132.1.91800 WP_000435132.1.91816 WP_000435132.1.91829 WP_000435132.1.91848 WP_000435132.1.91895 WP_000435132.1.91911 WP_000435132.1.91918 WP_000435132.1.91928 WP_000435132.1.91950 WP_000435132.1.91955 WP_000435132.1.91969 WP_000435132.1.92 WP_000435132.1.92055 WP_000435132.1.92057 WP_000435132.1.92104 WP_000435132.1.92110 WP_000435132.1.92115 WP_000435132.1.92125 WP_000435132.1.92133 WP_000435132.1.92140 WP_000435132.1.92158 WP_000435132.1.92164 WP_000435132.1.92169 WP_000435132.1.92173 WP_000435132.1.92185 WP_000435132.1.92186 WP_000435132.1.92196 WP_000435132.1.92212 WP_000435132.1.92218 WP_000435132.1.92227 WP_000435132.1.92228 WP_000435132.1.9224 WP_000435132.1.92244 WP_000435132.1.92249 WP_000435132.1.92253 WP_000435132.1.92259 WP_000435132.1.92278 WP_000435132.1.92297 WP_000435132.1.92303 WP_000435132.1.92324 WP_000435132.1.92340 WP_000435132.1.9239 WP_000435132.1.92391 WP_000435132.1.92405 WP_000435132.1.92415 WP_000435132.1.92424 WP_000435132.1.92425 WP_000435132.1.92436 WP_000435132.1.92442 WP_000435132.1.9247 WP_000435132.1.92497 WP_000435132.1.92500 WP_000435132.1.92512 WP_000435132.1.92520 WP_000435132.1.92534 WP_000435132.1.92541 WP_000435132.1.92560 WP_000435132.1.92565 WP_000435132.1.92602 WP_000435132.1.92607 WP_000435132.1.92667 WP_000435132.1.92674 WP_000435132.1.92679 WP_000435132.1.92691 WP_000435132.1.92718 WP_000435132.1.92723 WP_000435132.1.92726 WP_000435132.1.92735 WP_000435132.1.92741 WP_000435132.1.92765 WP_000435132.1.92772 WP_000435132.1.92773 WP_000435132.1.92789 WP_000435132.1.92795 WP_000435132.1.92805 WP_000435132.1.92840 WP_000435132.1.92849 WP_000435132.1.9286 WP_000435132.1.92862 WP_000435132.1.92864 WP_000435132.1.92897 WP_000435132.1.92918 WP_000435132.1.9293 WP_000435132.1.92937 WP_000435132.1.92950 WP_000435132.1.9296 WP_000435132.1.92960 WP_000435132.1.9298 WP_000435132.1.92997 WP_000435132.1.93047 WP_000435132.1.9305 WP_000435132.1.93068 WP_000435132.1.93071 WP_000435132.1.93074 WP_000435132.1.93125 WP_000435132.1.93147 WP_000435132.1.93163 WP_000435132.1.93176 WP_000435132.1.93186 WP_000435132.1.93191 WP_000435132.1.93197 WP_000435132.1.93231 WP_000435132.1.93235 WP_000435132.1.93237 WP_000435132.1.93243 WP_000435132.1.93251 WP_000435132.1.93254 WP_000435132.1.93260 WP_000435132.1.93272 WP_000435132.1.93300 WP_000435132.1.93316 WP_000435132.1.93329 WP_000435132.1.93336 WP_000435132.1.93354 WP_000435132.1.93378 WP_000435132.1.93416 WP_000435132.1.93435 WP_000435132.1.93438 WP_000435132.1.93444 WP_000435132.1.9346 WP_000435132.1.93471 WP_000435132.1.93492 WP_000435132.1.93514 WP_000435132.1.9352 WP_000435132.1.9354 WP_000435132.1.93561 WP_000435132.1.93567 WP_000435132.1.93579 WP_000435132.1.9358 WP_000435132.1.93590 WP_000435132.1.93658 WP_000435132.1.93678 WP_000435132.1.93690 WP_000435132.1.93708 WP_000435132.1.93710 WP_000435132.1.93722 WP_000435132.1.93736 WP_000435132.1.93738 WP_000435132.1.93758 WP_000435132.1.93762 WP_000435132.1.93769 WP_000435132.1.93775 WP_000435132.1.93787 WP_000435132.1.93862 WP_000435132.1.9387 WP_000435132.1.93882 WP_000435132.1.93883 WP_000435132.1.93890 WP_000435132.1.93891 WP_000435132.1.9392 WP_000435132.1.93934 WP_000435132.1.93972 WP_000435132.1.93976 WP_000435132.1.9398 WP_000435132.1.93981 WP_000435132.1.94 WP_000435132.1.94009 WP_000435132.1.94016 WP_000435132.1.94053 WP_000435132.1.94060 WP_000435132.1.94074 WP_000435132.1.9408 WP_000435132.1.94080 WP_000435132.1.94082 WP_000435132.1.94087 WP_000435132.1.94096 WP_000435132.1.94114 WP_000435132.1.94123 WP_000435132.1.94130 WP_000435132.1.94165 WP_000435132.1.94172 WP_000435132.1.94209 WP_000435132.1.94242 WP_000435132.1.94245 WP_000435132.1.94248 WP_000435132.1.94268 WP_000435132.1.94287 WP_000435132.1.94293 WP_000435132.1.94294 WP_000435132.1.9430 WP_000435132.1.94319 WP_000435132.1.94320 WP_000435132.1.94324 WP_000435132.1.94325 WP_000435132.1.94335 WP_000435132.1.94337 WP_000435132.1.94340 WP_000435132.1.94341 WP_000435132.1.94345 WP_000435132.1.9435 WP_000435132.1.9437 WP_000435132.1.94375 WP_000435132.1.94376 WP_000435132.1.94409 WP_000435132.1.94414 WP_000435132.1.94423 WP_000435132.1.94484 WP_000435132.1.94505 WP_000435132.1.94530 WP_000435132.1.94536 WP_000435132.1.94549 WP_000435132.1.9455 WP_000435132.1.94550 WP_000435132.1.94576 WP_000435132.1.94636 WP_000435132.1.9464 WP_000435132.1.94641 WP_000435132.1.94684 WP_000435132.1.94688 WP_000435132.1.947 WP_000435132.1.94733 WP_000435132.1.94741 WP_000435132.1.94789 WP_000435132.1.94797 WP_000435132.1.94825 WP_000435132.1.94844 WP_000435132.1.94845 WP_000435132.1.94857 WP_000435132.1.94866 WP_000435132.1.94941 WP_000435132.1.9495 WP_000435132.1.94958 WP_000435132.1.94969 WP_000435132.1.94980 WP_000435132.1.94989 WP_000435132.1.94992 WP_000435132.1.94999 WP_000435132.1.95008 WP_000435132.1.95014 WP_000435132.1.95023 WP_000435132.1.95029 WP_000435132.1.95049 WP_000435132.1.95077 WP_000435132.1.95090 WP_000435132.1.9510 WP_000435132.1.95120 WP_000435132.1.95154 WP_000435132.1.95156 WP_000435132.1.95174 WP_000435132.1.95193 WP_000435132.1.95210 WP_000435132.1.95263 WP_000435132.1.95281 WP_000435132.1.95294 WP_000435132.1.95304 WP_000435132.1.95307 WP_000435132.1.95327 WP_000435132.1.95342 WP_000435132.1.95361 WP_000435132.1.95372 WP_000435132.1.95386 WP_000435132.1.95409 WP_000435132.1.95415 WP_000435132.1.95452 WP_000435132.1.95476 WP_000435132.1.95494 WP_000435132.1.95495 WP_000435132.1.95500 WP_000435132.1.95505 WP_000435132.1.95512 WP_000435132.1.95519 WP_000435132.1.95522 WP_000435132.1.95537 WP_000435132.1.95560 WP_000435132.1.9557 WP_000435132.1.95571 WP_000435132.1.95581 WP_000435132.1.95603 WP_000435132.1.9563 WP_000435132.1.95639 WP_000435132.1.95681 WP_000435132.1.95683 WP_000435132.1.95699 WP_000435132.1.95704 WP_000435132.1.95713 WP_000435132.1.95714 WP_000435132.1.95737 WP_000435132.1.95760 WP_000435132.1.95780 WP_000435132.1.95781 WP_000435132.1.95804 WP_000435132.1.95806 WP_000435132.1.95885 WP_000435132.1.959 WP_000435132.1.95918 WP_000435132.1.95947 WP_000435132.1.95962 WP_000435132.1.95983 WP_000435132.1.95986 WP_000435132.1.95997 WP_000435132.1.96014 WP_000435132.1.96022 WP_000435132.1.96030 WP_000435132.1.96056 WP_000435132.1.96057 WP_000435132.1.96067 WP_000435132.1.96075 WP_000435132.1.96133 WP_000435132.1.96135 WP_000435132.1.96148 WP_000435132.1.96160 WP_000435132.1.96163 WP_000435132.1.96165 WP_000435132.1.96200 WP_000435132.1.96218 WP_000435132.1.96221 WP_000435132.1.96228 WP_000435132.1.96255 WP_000435132.1.96261 WP_000435132.1.96271 WP_000435132.1.96283 WP_000435132.1.96297 WP_000435132.1.96301 WP_000435132.1.96305 WP_000435132.1.96312 WP_000435132.1.96314 WP_000435132.1.96316 WP_000435132.1.96322 WP_000435132.1.96334 WP_000435132.1.96362 WP_000435132.1.96368 WP_000435132.1.96412 WP_000435132.1.96433 WP_000435132.1.96472 WP_000435132.1.96474 WP_000435132.1.96495 WP_000435132.1.9650 WP_000435132.1.96509 WP_000435132.1.96535 WP_000435132.1.96538 WP_000435132.1.96548 WP_000435132.1.96550 WP_000435132.1.96554 WP_000435132.1.96566 WP_000435132.1.96568 WP_000435132.1.96591 WP_000435132.1.96603 WP_000435132.1.96613 WP_000435132.1.96634 WP_000435132.1.96646 WP_000435132.1.96654 WP_000435132.1.96678 WP_000435132.1.96682 WP_000435132.1.96699 WP_000435132.1.96705 WP_000435132.1.96727 WP_000435132.1.9675 WP_000435132.1.96770 WP_000435132.1.96804 WP_000435132.1.9684 WP_000435132.1.96854 WP_000435132.1.96855 WP_000435132.1.96856 WP_000435132.1.96859 WP_000435132.1.96866 WP_000435132.1.96882 WP_000435132.1.96895 WP_000435132.1.96918 WP_000435132.1.96922 WP_000435132.1.9695 WP_000435132.1.96965 WP_000435132.1.96969 WP_000435132.1.96976 WP_000435132.1.96985 WP_000435132.1.96997 WP_000435132.1.97000 WP_000435132.1.97001 WP_000435132.1.97004 WP_000435132.1.97007 WP_000435132.1.97014 WP_000435132.1.97019 WP_000435132.1.97029 WP_000435132.1.97034 WP_000435132.1.97072 WP_000435132.1.97077 WP_000435132.1.97117 WP_000435132.1.97138 WP_000435132.1.97139 WP_000435132.1.97141 WP_000435132.1.97151 WP_000435132.1.97161 WP_000435132.1.97164 WP_000435132.1.97191 WP_000435132.1.97205 WP_000435132.1.97206 WP_000435132.1.97228 WP_000435132.1.97230 WP_000435132.1.97241 WP_000435132.1.97267 WP_000435132.1.97276 WP_000435132.1.97293 WP_000435132.1.97295 WP_000435132.1.97311 WP_000435132.1.97312 WP_000435132.1.97336 WP_000435132.1.97348 WP_000435132.1.97352 WP_000435132.1.97355 WP_000435132.1.97367 WP_000435132.1.9737 WP_000435132.1.97392 WP_000435132.1.97399 WP_000435132.1.97411 WP_000435132.1.97427 WP_000435132.1.97444 WP_000435132.1.97450 WP_000435132.1.97456 WP_000435132.1.97468 WP_000435132.1.97484 WP_000435132.1.97494 WP_000435132.1.97530 WP_000435132.1.97531 WP_000435132.1.97536 WP_000435132.1.97537 WP_000435132.1.97574 WP_000435132.1.97576 WP_000435132.1.97585 WP_000435132.1.97627 WP_000435132.1.97664 WP_000435132.1.97687 WP_000435132.1.97688 WP_000435132.1.97696 WP_000435132.1.97699 WP_000435132.1.97706 WP_000435132.1.97717 WP_000435132.1.97720 WP_000435132.1.97731 WP_000435132.1.97739 WP_000435132.1.97744 WP_000435132.1.97746 WP_000435132.1.97762 WP_000435132.1.97763 WP_000435132.1.97776 WP_000435132.1.97827 WP_000435132.1.97835 WP_000435132.1.9788 WP_000435132.1.9789 WP_000435132.1.97898 WP_000435132.1.97899 WP_000435132.1.97928 WP_000435132.1.97935 WP_000435132.1.97955 WP_000435132.1.97974 WP_000435132.1.97997 WP_000435132.1.97999 WP_000435132.1.98008 WP_000435132.1.98011 WP_000435132.1.98033 WP_000435132.1.98051 WP_000435132.1.98054 WP_000435132.1.98058 WP_000435132.1.98073 WP_000435132.1.98077 WP_000435132.1.98161 WP_000435132.1.98174 WP_000435132.1.98195 WP_000435132.1.98233 WP_000435132.1.98242 WP_000435132.1.98248 WP_000435132.1.98249 WP_000435132.1.98281 WP_000435132.1.98295 WP_000435132.1.98322 WP_000435132.1.98328 WP_000435132.1.98352 WP_000435132.1.98353 WP_000435132.1.98359 WP_000435132.1.98360 WP_000435132.1.98361 WP_000435132.1.98366 WP_000435132.1.98372 WP_000435132.1.98387 WP_000435132.1.98394 WP_000435132.1.98409 WP_000435132.1.98411 WP_000435132.1.98415 WP_000435132.1.98419 WP_000435132.1.98425 WP_000435132.1.98456 WP_000435132.1.98497 WP_000435132.1.98501 WP_000435132.1.98506 WP_000435132.1.98510 WP_000435132.1.98512 WP_000435132.1.98533 WP_000435132.1.98552 WP_000435132.1.98585 WP_000435132.1.98586 WP_000435132.1.986 WP_000435132.1.98609 WP_000435132.1.98655 WP_000435132.1.98659 WP_000435132.1.98667 WP_000435132.1.98703 WP_000435132.1.98706 WP_000435132.1.9872 WP_000435132.1.98723 WP_000435132.1.98730 WP_000435132.1.98734 WP_000435132.1.98741 WP_000435132.1.98750 WP_000435132.1.98767 WP_000435132.1.98786 WP_000435132.1.98821 WP_000435132.1.98825 WP_000435132.1.98837 WP_000435132.1.98842 WP_000435132.1.98858 WP_000435132.1.98865 WP_000435132.1.98874 WP_000435132.1.98880 WP_000435132.1.98883 WP_000435132.1.98894 WP_000435132.1.98924 WP_000435132.1.98967 WP_000435132.1.98978 WP_000435132.1.98985 WP_000435132.1.99009 WP_000435132.1.99025 WP_000435132.1.9903 WP_000435132.1.99090 WP_000435132.1.9910 WP_000435132.1.9912 WP_000435132.1.99136 WP_000435132.1.99155 WP_000435132.1.99171 WP_000435132.1.99183 WP_000435132.1.99195 WP_000435132.1.99207 WP_000435132.1.99249 WP_000435132.1.99262 WP_000435132.1.99280 WP_000435132.1.99283 WP_000435132.1.99308 WP_000435132.1.99311 WP_000435132.1.99359 WP_000435132.1.9936 WP_000435132.1.99394 WP_000435132.1.99405 WP_000435132.1.99414 WP_000435132.1.99418 WP_000435132.1.99430 WP_000435132.1.99459 WP_000435132.1.99492 WP_000435132.1.99494 WP_000435132.1.99509 WP_000435132.1.99519 WP_000435132.1.99523 WP_000435132.1.99524 WP_000435132.1.99525 WP_000435132.1.99536 WP_000435132.1.99538 WP_000435132.1.99564 WP_000435132.1.99569 WP_000435132.1.9960 WP_000435132.1.99631 WP_000435132.1.99638 WP_000435132.1.9965 WP_000435132.1.99683 WP_000435132.1.99688 WP_000435132.1.99714 WP_000435132.1.99759 WP_000435132.1.99768 WP_000435132.1.99777 WP_000435132.1.99802 WP_000435132.1.99830 WP_000435132.1.99849 WP_000435132.1.9985 WP_000435132.1.99850 WP_000435132.1.99859 WP_000435132.1.99860 WP_000435132.1.99862 WP_000435132.1.9987 WP_000435132.1.99884 WP_000435132.1.99926 WP_000435132.1.99950 WP_000435132.1.99954 WP_000435132.1.99955 WP_000435132.1.99956 WP_000435132.1.99963 WP_000435132.1.99979 WP_000435132.1.99984 WP_000435132.1.99985 gi|57650554|ref|YP_186567.1| gi|470219148|ref|YP_007619542.1| gi|21283355|ref|NP_646443.1| gi|151221788|ref|YP_001332610.1| gi|387150827|ref|YP_005742391.1| gi|387143280|ref|YP_005731673.1| gi|470191515|ref|YP_007577825.1| gi|384550499|ref|YP_005739751.1| gi|386831282|ref|YP_006237936.1| gi|384867354|ref|YP_005747550.1| gi|269203301|ref|YP_003282570.1| gi|470193480|ref|YP_007579833.1| gi|537461370|ref|YP_008491810.1| 196620.MW1626 282458.SAR1762 282459.SAS1611 359786.SaurJH9_1740 359787.SaurJH1_1774 426430.NWMN_1576 451515.SAUSA300_1629 451516.USA300HOU_1669 681288.SAAV_1672 93062.SACOL1729 gi|384870220|ref|YP_005752934.1| gi|148268163|ref|YP_001247106.1| gi|554644488|ref|YP_008716279.1| gi|161509896|ref|YP_001575555.1| gi|470222969|ref|YP_007621526.1| gi|470197411|ref|YP_007583812.1| gi|49483925|ref|YP_041149.1| gi|384864894|ref|YP_005750253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]