SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o4xA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o4xA
Domain Number 1 Region: 9-78
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.81e-62
Family POU-specific domain 0.0029
Further Details:      
 
Domain Number 2 Region: 83-163
Classification Level Classification E-value
Superfamily Homeodomain-like 2.82e-19
Family Homeodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o4xA   PDB: 1o4x
Sequence length 167
Comment (A:)
Sequence
gshmeepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnls
fknmaklkpllekwlndaenlssdsslsspsalnspgieglserrkkrtsietnirvale
ksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinppss
Download sequence
Identical sequences 1o4x_A 1o4xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]