SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ocpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ocpA
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily Homeodomain-like 8.73e-18
Family Homeodomain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ocpA   PDB: 1ocp   SUPERFAMILY: 1ocpA
Sequence length 67
Comment (A:)
Sequence
metlvqarkrkrtsienrvrwsletmflkcpkpslqqithianqlglekdvvrvwfcnrr
qkgkrss
Download sequence
Identical sequences 1ocp_A 1ocpA cath|current|1ocpA00/1-67 d1ocpa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]