SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ofcX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ofcX
Domain Number 1 Region: 28-111
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 2.2e-54
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.00046
Further Details:      
 
Domain Number 2 Region: 164-288
Classification Level Classification E-value
Superfamily Homeodomain-like 3.73e-46
Family SLIDE domain 0.000000435
Further Details:      
 
Domain Number 3 Region: 113-168
Classification Level Classification E-value
Superfamily Homeodomain-like 9.53e-17
Family Myb/SANT domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ofcX   PDB: 1ofc
Sequence length 304
Comment (X:)
Sequence
gamerkanyavdayfrealrvsepkapkaprppkqpivqdfqffpprlfelldqeiyyfr
ktvgykvpkntelgsdatkvqreeqrkideaeplteeeiqekenllsqgftawtkrdfnq
fikanekygrddidniakdvegktpeevieynavfwerctelqdierimgqiergegkiq
rrlsikkaldqkmsryrapfhqlrlqygnnkgknyteiedrflvcmlhklgfdkenvyee
lraairaspqfrfdwfiksrtalelqrrcntlitlierenieleekeraekkkkapkgsv
sags
Download sequence
Identical sequences 1ofcX 1ofc_X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]