SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1offA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1offA
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.07e-52
Family 2Fe-2S ferredoxin-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1offA   PDB: 1off   SUPERFAMILY: 1offA
Sequence length 97
Comment (A:)
Sequence
MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQS
DQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Download sequence
Identical sequences L8AP52 P27320
gi|383323140|ref|YP_005383993.1| 1offA 1off_A WP_010873424.1.11876 WP_010873424.1.1889 WP_010873424.1.18904 WP_010873424.1.33690 WP_010873424.1.35395 WP_010873424.1.47586 WP_010873424.1.99424 gi|16331399|ref|NP_442127.1| gi|383492193|ref|YP_005409869.1| gi|383326309|ref|YP_005387162.1| cath|current|1offA00/2-96 1148.ssl0020 gi|16331399|ref|NP_442127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]