SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ohtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ohtA
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.83e-65
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ohtA   PDB: 1oht   SUPERFAMILY: 1ohtA
Sequence length 215
Comment (A:)
Sequence
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTE
LPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHIND
TEGVSSTTAPVVPHVHPQAAAPQKPHQSPPAAPKV
Download sequence
Identical sequences A4V2P5
FBpp0081873 FBpp0081874 1ohtA NP_001247053.1.81976 NP_001247054.1.81976 NP_650079.1.81976 NP_731576.1.81976 1oht_A FBpp0081873 FBpp0081874 FBpp0297235 FBpp0297236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]