SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1omoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1omoA
Domain Number 1 Region: 1-320
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.81e-107
Family Ornithine cyclodeaminase-like 0.0000000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1omoA   PDB: 1omo   SUPERFAMILY: 1omoA
Sequence length 322
Comment (A:)
Sequence
METLILTQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVYLEFEKGDLRAMPAHLMG
YAGLKWVNSHPGNPDKGLPTVMALMILNSPETGFPLAVMDATYTTSLRTGAAGGIAAKYL
ARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAYDVREKAAKKFVSYCEDRGISASVQ
PAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVVDD
LEQAKHGGEINVAVSKGVIGVEDVHATIGEVIAGLKDGRESDEEITIFDSTGLAIQDVAV
AKVVYENALSKNVGSKIKFFRI
Download sequence
Identical sequences A0A075WE43 A0A101DYW6 O28608
1omoA gi|11499255|ref|NP_070493.1| 1omo_A 1omo_B 354281 224325.AF1665 WP_010879161.1.27515 WP_010879161.1.34637 WP_010879161.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]