SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1oogA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1oogA
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.66e-32
Family Insect pheromone/odorant-binding proteins 0.00000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1oogA   PDB: 1oog   SUPERFAMILY: 1oogA
Sequence length 124
Comment (A:)
Sequence
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp
Download sequence
Identical sequences 000049466|e1oogA1|108.2.1.1|A:1-124 000049467|e1oogB1|108.2.1.1|B:1-124 000049468|e1t14A1|108.2.1.1|A:1-124 000049469|e1ooiX1|108.2.1.1|X:1-124 000049470|e2gteB1|108.2.1.1|B:1-124 000049471|e1oofB1|108.2.1.1|B:1-124 000049472|e1oofA1|108.2.1.1|A:1-124 000049474|e1t14B1|108.2.1.1|B:1-124 000049475|e2gteA1|108.2.1.1|A:1-124 cath|current|1oofA00/1-124 cath|current|1oofB00/1-124 cath|current|1oogA00/1-124 cath|current|1oogB00/1-124 cath|current|1ooiX00/1-124 cath|current|1t14A00/1-124 cath|current|1t14B00/1-124 cath|current|2gteA00/1-124 cath|current|2gteB00/1-124 d1oofa_ d1oofb_ d1ooga_ d1oogb_ d1ooha1 d1oohb1 d1ooix_ d1t14a_ d1t14b_ d2gtea_ d2gteb_ 1oogA 1oof_A 1oof_B 1oog_A 1oog_B 1ooi_X 1t14_A 1t14_B 2gte_A 2gte_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]