SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1opzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1opzA
Domain Number 1 Region: 11-71
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.05e-34
Family HMA, heavy metal-associated domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1opzA   PDB: 1opz   SUPERFAMILY: 1opzA
Sequence length 76
Comment (A:)
Sequence
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvviegr
Download sequence
Identical sequences CIRMMP05 1opzA cath|current|1opzA00/1-76 cath|current|1oq3A00/1-76 cath|current|1oq6A00/1-76 1opz_A 1oq3_A 1oq6_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]