SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1orgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1orgA
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 5.86e-24
Family Insect pheromone/odorant-binding proteins 0.000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1orgA   PDB: 1org   SUPERFAMILY: 1orgA
Sequence length 118
Comment (A:)
Sequence
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
Download sequence
Identical sequences 000049463|e1orgA1|108.2.1.10|A:1-118 000049464|e1orgB1|108.2.1.10|B:1-118 cath|current|1orgA00/1-118 cath|current|1orgB00/1-118 d1orga_ d1orgb_ d1ow4a1 d1ow4b1 1orgA 1org_A 1org_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]