SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ovyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ovyA
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Translational machinery components 9.22e-58
Family Ribosomal protein L18 and S11 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ovyA   PDB: 1ovy   SUPERFAMILY: 1ovyA
Sequence length 120
Comment (A:)
Sequence
MITKVDRNAVRKKRHARIRKKIFGTTERPRLSVFRSNKHIYAQIIDDTKSATIVSASTLD
KEFGLDSTNNIEAAKKVGELVAKRALEKGIKQVVFDRGGYLYHGRVKALADAAREAGLEF
Download sequence
Identical sequences A0A087LHL0 A0A0G3XUP8 A0A0K1KCI2 A0A0Q1EXT9 A0A164AU28 A0A223DX43 P09415
1ovyA WP_033008681.1.14676 WP_033008681.1.20351 WP_033008681.1.24107 WP_033008681.1.26402 WP_033008681.1.30801 WP_033008681.1.38513 WP_033008681.1.43576 WP_033008681.1.44827 WP_033008681.1.46681 WP_033008681.1.54348 WP_033008681.1.56669 WP_033008681.1.58461 WP_033008681.1.59290 WP_033008681.1.62042 1ovy_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]