SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ow4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ow4A
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 7.18e-24
Family Insect pheromone/odorant-binding proteins 0.000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ow4A   PDB: 1ow4   SUPERFAMILY: 1ow4A
Sequence length 129
Comment (A:)
Sequence
mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
ftdcvrnsy
Download sequence
Identical sequences cath|current|1ow4A00/-1-118 cath|current|1ow4B00/0-118 cath|current|1p28A00/-1-117 cath|current|1p28B00/2-118 1ow4_A 1ow4_B 1p28_A 1p28_B 1ow4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]