SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ox3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ox3A
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Fibritin 9.88e-50
Family Fibritin 0.000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ox3A   PDB: 1ox3   SUPERFAMILY: 1ox3A
Sequence length 109
Comment (A:)
Sequence
adivlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldk
nigilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl
Download sequence
Identical sequences cath|current|1ox3A00/2-109 1ox3A 1ox3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]