SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1oxkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1oxkA
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.81e-31
Family Phosphorelay protein-like 0.0000000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1oxkA   PDB: 1oxk   SUPERFAMILY: 1oxkA
Sequence length 166
Comment (A:)
Sequence
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
Download sequence
Identical sequences 1oxb_A 1oxk_A 1oxk_C 1oxk_E 1oxk_G 1oxk_I 1oxk_K 000003719|e2r25A1|601.3.1.1|A:2-167 000054440|e1oxkE1|601.3.1.1|E:1-166 000054441|e1oxkG1|601.3.1.1|G:1-166 000054442|e1c03B1|601.3.1.1|B:2-167 000054443|e1oxbA1|601.3.1.1|A:1-166 000054444|e1oxkC1|601.3.1.1|C:1-166 000054445|e1c03D1|601.3.1.1|D:2-167 000054446|e1c03C1|601.3.1.1|C:2-167 000054448|e1oxkI1|601.3.1.1|I:1-166 000054451|e1oxkA1|601.3.1.1|A:1-166 000054453|e1c03A1|601.3.1.1|A:2-167 000054454|e1oxkK1|601.3.1.1|K:1-166 cath|current|1oxbA00/2-167 cath|current|1oxkA00/2-167 cath|current|1oxkC00/2-167 cath|current|1oxkE00/2-167 cath|current|1oxkG00/2-167 cath|current|1oxkI00/2-167 cath|current|1oxkK00/2-167 d1oxba_ d1oxka_ d1oxkc_ d1oxke_ d1oxkg_ d1oxki_ d1oxkk_ d2r25a_ 1oxkA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]