SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ozhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ozhA
Domain Number 1 Region: 371-550
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.09e-51
Family Pyruvate oxidase and decarboxylase PP module 0.0000000173
Further Details:      
 
Domain Number 2 Region: 13-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.42e-49
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000718
Further Details:      
 
Domain Number 3 Region: 190-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.87e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ozhA   PDB: 1ozh
Sequence length 566
Comment (A:)
Sequence
mdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheana
afmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhq
smdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkv
lpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvts
tyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatl
vhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelld
rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqq
tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
vdyrdnpllmgqlhlsqilehhhhhh
Download sequence
Identical sequences 1ozf_A 1ozf_B 1ozg_A 1ozg_B 1ozh_A 1ozh_B 1ozh_C 1ozh_D 1ozhA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]