SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p1mA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p1mA
Domain Number 1 Region: 51-328
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.15e-84
Family SAH/MTA deaminase-like 0.000000000104
Further Details:      
 
Domain Number 2 Region: 1-49,330-403
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 9.29e-31
Family SAH/MTA deaminase-like 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1p1mA   PDB: 1p1m
Sequence length 406
Comment (A:)
Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPM
TLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEW
IAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSE
EYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVL
KDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQ
KAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHL
VHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYSS
Download sequence
Identical sequences G4FF54 Q9X034
NP_228744.1.35502 WP_004080626.1.29620 WP_004080626.1.45724 WP_004080626.1.51363 WP_004080626.1.56403 WP_004080626.1.79805 1p1m_A 2plm_A gi|15643698|ref|NP_228744.1| 282805 APC4484 1p1mA gi|15643698|ref|NP_228744.1| 243274.TM0936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]