SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p22B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p22B
Domain Number 1 Region: 85-143
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.56e-50
Family Skp1 dimerisation domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily POZ domain 7.76e-39
Family BTB/POZ domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1p22B   PDB: 1p22
Sequence length 145
Comment (B:)
Sequence
mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
ddppddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwceek
Download sequence
Identical sequences cath|current|1p22B00/2-136 1p22B 1p22_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]