SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p7jA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p7jA
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily Homeodomain-like 5.88e-27
Family Homeodomain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1p7jA   PDB: 1p7j   SUPERFAMILY: 1p7jA
Sequence length 59
Comment (A:)
Sequence
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnerakikks
Download sequence
Identical sequences cath|current|1p7jA00/3-55 cath|current|1p7jB00/7-57 cath|current|1p7jC00/6-57 cath|current|1p7jD00/6-58 1p7j_A 1p7j_B 1p7j_C 1p7j_D 1p7jA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]