SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pavA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pavA
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily SirA-like 5.34e-21
Family SirA-like 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pavA   PDB: 1pav   SUPERFAMILY: 1pavA
Sequence length 78
Comment (A:)
Sequence
MDVKPDRVIDARGSYCPGPLMELIKAYKQAKVGEVISVYSTDAGTKKDAPAWIQKSGQEL
VGVFDRNGYYEIVMKKVK
Download sequence
Identical sequences Q9HI35
APC5679 WP_010901577.1.49201 1pav_A gi|16082182|ref|NP_394626.1| gi|16082387|ref|NP_394868.1| 1pavA 000005634|e1pavA1|328.5.1.1|A:1-78 cath|current|1pavA00/1-78 d1pava_ 273075.Ta1170 273075.Ta1414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]