SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pc4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pc4A
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.27e-23
Family 7-Fe ferredoxin 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pc4A   PDB: 1pc4   SUPERFAMILY: 1pc4A
Sequence length 107
Comment (A:)
Sequence
mafvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecaaqaifsede
vpedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences cath|current|1pc4A00/1-106 1pc4A 1pc4_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]