SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pc5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pc5A
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.26e-23
Family 7-Fe ferredoxin 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pc5A   PDB: 1pc5   SUPERFAMILY: 1pc5A
Sequence length 107
Comment (A:)
Sequence
mafvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecgaqaifsede
vpedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1pc5A 1pc5_A cath|current|1pc5A00/1-106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]