SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pfdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pfdA
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.55e-46
Family 2Fe-2S ferredoxin-related 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pfdA   PDB: 1pfd   SUPERFAMILY: 1pfdA
Sequence length 96
Comment (A:)
Sequence
ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSD
QSFLDDEQMDAGYVLTCHAYPTSDVVIETHKEEEIV
Download sequence
Identical sequences Q7M1S1
1pfd_A cath|current|1pfdA00/1-96 d1pfda_ 1pfdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]