SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pjqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pjqA
Domain Number 1 Region: 215-449
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3e-144
Family Tetrapyrrole methylase 0.00000218
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.05e-28
Family Siroheme synthase N-terminal domain-like 0.00000121
Further Details:      
 
Domain Number 3 Region: 114-208
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.1e-27
Family Siroheme synthase middle domains-like 0.00000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pjqA   PDB: 1pjq
Sequence length 457
Comment (A:)
Sequence
MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTFIPQFTVWANEGMLTL
VEGPFDETLLDSCWLAIAATDDDTVNQRVSDAAESRRIFCNVVDAPKAASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYAGQLRARVKKQFATMGERRRFWE
KFFVNDRLAQSLANADEKAVNATTERLFSEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADIVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLK
GGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHL
KTGGELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVH
GVLTQLGELAQQVESPALIIVGRVVALRDKLNWFSNH
Download sequence
Identical sequences A0A0F6B7S9 A0A0F7JCI1 A0A0H3NGV5 A0A0T9W9R3 A0A0W4SD31 A0A249UTD2 A0A2D0MLW0 A0A2D3AHA8 A0A2H9YAI6 E8XEI0 P25924
gi|378446853|ref|YP_005234485.1| gi|526218583|ref|YP_008263775.1| gi|482906044|ref|YP_007904604.1| gi|549726032|ref|YP_008646222.1| gi|379702737|ref|YP_005244465.1| 1pjqA gi|550902822|ref|YP_008671914.1| gi|16766765|ref|NP_462380.1| 99287.STM3477 1pjq_A 1pjq_B 1pjs_A 1pjs_B gi|378701371|ref|YP_005183329.1| NP_462380.1.58477 WP_000349895.1.100010 WP_000349895.1.100234 WP_000349895.1.100258 WP_000349895.1.100376 WP_000349895.1.100424 WP_000349895.1.100436 WP_000349895.1.100484 WP_000349895.1.100488 WP_000349895.1.100597 WP_000349895.1.10076 WP_000349895.1.100781 WP_000349895.1.100793 WP_000349895.1.100869 WP_000349895.1.100871 WP_000349895.1.100882 WP_000349895.1.101007 WP_000349895.1.101020 WP_000349895.1.101074 WP_000349895.1.101078 WP_000349895.1.101180 WP_000349895.1.101259 WP_000349895.1.101284 WP_000349895.1.101291 WP_000349895.1.101320 WP_000349895.1.101353 WP_000349895.1.101386 WP_000349895.1.101404 WP_000349895.1.101420 WP_000349895.1.101589 WP_000349895.1.101707 WP_000349895.1.101734 WP_000349895.1.101878 WP_000349895.1.101953 WP_000349895.1.10220 WP_000349895.1.10266 WP_000349895.1.10429 WP_000349895.1.10439 WP_000349895.1.10678 WP_000349895.1.10753 WP_000349895.1.10992 WP_000349895.1.11000 WP_000349895.1.11024 WP_000349895.1.11031 WP_000349895.1.11098 WP_000349895.1.11168 WP_000349895.1.11190 WP_000349895.1.11295 WP_000349895.1.11455 WP_000349895.1.11458 WP_000349895.1.11518 WP_000349895.1.11532 WP_000349895.1.11543 WP_000349895.1.11763 WP_000349895.1.11772 WP_000349895.1.11897 WP_000349895.1.12025 WP_000349895.1.12114 WP_000349895.1.12351 WP_000349895.1.12370 WP_000349895.1.12546 WP_000349895.1.1264 WP_000349895.1.12728 WP_000349895.1.12879 WP_000349895.1.12936 WP_000349895.1.12995 WP_000349895.1.13027 WP_000349895.1.13106 WP_000349895.1.13130 WP_000349895.1.13334 WP_000349895.1.13414 WP_000349895.1.13488 WP_000349895.1.13509 WP_000349895.1.13669 WP_000349895.1.13741 WP_000349895.1.1387 WP_000349895.1.13908 WP_000349895.1.13932 WP_000349895.1.13968 WP_000349895.1.14001 WP_000349895.1.14151 WP_000349895.1.14320 WP_000349895.1.14379 WP_000349895.1.14406 WP_000349895.1.14410 WP_000349895.1.14466 WP_000349895.1.14524 WP_000349895.1.14554 WP_000349895.1.14725 WP_000349895.1.14852 WP_000349895.1.1489 WP_000349895.1.14932 WP_000349895.1.15055 WP_000349895.1.15124 WP_000349895.1.15223 WP_000349895.1.15226 WP_000349895.1.15316 WP_000349895.1.15369 WP_000349895.1.1540 WP_000349895.1.15508 WP_000349895.1.15784 WP_000349895.1.15830 WP_000349895.1.16062 WP_000349895.1.16063 WP_000349895.1.16103 WP_000349895.1.16226 WP_000349895.1.16233 WP_000349895.1.16284 WP_000349895.1.16328 WP_000349895.1.1635 WP_000349895.1.16468 WP_000349895.1.16650 WP_000349895.1.16686 WP_000349895.1.16691 WP_000349895.1.167 WP_000349895.1.16732 WP_000349895.1.16735 WP_000349895.1.16786 WP_000349895.1.16858 WP_000349895.1.16896 WP_000349895.1.16916 WP_000349895.1.16965 WP_000349895.1.1700 WP_000349895.1.17307 WP_000349895.1.174 WP_000349895.1.17480 WP_000349895.1.17546 WP_000349895.1.17702 WP_000349895.1.17705 WP_000349895.1.18019 WP_000349895.1.18111 WP_000349895.1.18163 WP_000349895.1.18265 WP_000349895.1.18267 WP_000349895.1.18282 WP_000349895.1.18468 WP_000349895.1.18607 WP_000349895.1.18705 WP_000349895.1.18715 WP_000349895.1.18776 WP_000349895.1.18822 WP_000349895.1.18881 WP_000349895.1.18940 WP_000349895.1.18949 WP_000349895.1.19053 WP_000349895.1.19320 WP_000349895.1.19458 WP_000349895.1.19460 WP_000349895.1.19461 WP_000349895.1.19614 WP_000349895.1.19642 WP_000349895.1.19702 WP_000349895.1.19706 WP_000349895.1.19724 WP_000349895.1.19784 WP_000349895.1.19802 WP_000349895.1.19809 WP_000349895.1.19867 WP_000349895.1.1998 WP_000349895.1.20 WP_000349895.1.2010 WP_000349895.1.20212 WP_000349895.1.20266 WP_000349895.1.20271 WP_000349895.1.20330 WP_000349895.1.20362 WP_000349895.1.20418 WP_000349895.1.20443 WP_000349895.1.20525 WP_000349895.1.2054 WP_000349895.1.20553 WP_000349895.1.20626 WP_000349895.1.20646 WP_000349895.1.20886 WP_000349895.1.20908 WP_000349895.1.21049 WP_000349895.1.21146 WP_000349895.1.21245 WP_000349895.1.21246 WP_000349895.1.21269 WP_000349895.1.21400 WP_000349895.1.21497 WP_000349895.1.21499 WP_000349895.1.21548 WP_000349895.1.21603 WP_000349895.1.21751 WP_000349895.1.21757 WP_000349895.1.22024 WP_000349895.1.22030 WP_000349895.1.2205 WP_000349895.1.22062 WP_000349895.1.22067 WP_000349895.1.2221 WP_000349895.1.2235 WP_000349895.1.22379 WP_000349895.1.22427 WP_000349895.1.2246 WP_000349895.1.22485 WP_000349895.1.22537 WP_000349895.1.22620 WP_000349895.1.22870 WP_000349895.1.22979 WP_000349895.1.23102 WP_000349895.1.23114 WP_000349895.1.2314 WP_000349895.1.23192 WP_000349895.1.23259 WP_000349895.1.23460 WP_000349895.1.23472 WP_000349895.1.23482 WP_000349895.1.23634 WP_000349895.1.2364 WP_000349895.1.23932 WP_000349895.1.24017 WP_000349895.1.24206 WP_000349895.1.24308 WP_000349895.1.24578 WP_000349895.1.24737 WP_000349895.1.24779 WP_000349895.1.25008 WP_000349895.1.25015 WP_000349895.1.25206 WP_000349895.1.25405 WP_000349895.1.25454 WP_000349895.1.25493 WP_000349895.1.25668 WP_000349895.1.25690 WP_000349895.1.2570 WP_000349895.1.25740 WP_000349895.1.25814 WP_000349895.1.25988 WP_000349895.1.26282 WP_000349895.1.26311 WP_000349895.1.26319 WP_000349895.1.26429 WP_000349895.1.26440 WP_000349895.1.26493 WP_000349895.1.26551 WP_000349895.1.26567 WP_000349895.1.27010 WP_000349895.1.27173 WP_000349895.1.27206 WP_000349895.1.27423 WP_000349895.1.27561 WP_000349895.1.2763 WP_000349895.1.27665 WP_000349895.1.27707 WP_000349895.1.27761 WP_000349895.1.2777 WP_000349895.1.27857 WP_000349895.1.27977 WP_000349895.1.28094 WP_000349895.1.28126 WP_000349895.1.28170 WP_000349895.1.28302 WP_000349895.1.2835 WP_000349895.1.28538 WP_000349895.1.28575 WP_000349895.1.28625 WP_000349895.1.28655 WP_000349895.1.28694 WP_000349895.1.2879 WP_000349895.1.2890 WP_000349895.1.28938 WP_000349895.1.28946 WP_000349895.1.29006 WP_000349895.1.29010 WP_000349895.1.2910 WP_000349895.1.29588 WP_000349895.1.29601 WP_000349895.1.29606 WP_000349895.1.29615 WP_000349895.1.29619 WP_000349895.1.29704 WP_000349895.1.29969 WP_000349895.1.30006 WP_000349895.1.30027 WP_000349895.1.30180 WP_000349895.1.30469 WP_000349895.1.30505 WP_000349895.1.30507 WP_000349895.1.30535 WP_000349895.1.30547 WP_000349895.1.30794 WP_000349895.1.30833 WP_000349895.1.30835 WP_000349895.1.30972 WP_000349895.1.31 WP_000349895.1.3113 WP_000349895.1.31185 WP_000349895.1.3119 WP_000349895.1.31190 WP_000349895.1.31195 WP_000349895.1.31196 WP_000349895.1.31219 WP_000349895.1.31281 WP_000349895.1.31362 WP_000349895.1.31504 WP_000349895.1.31515 WP_000349895.1.31578 WP_000349895.1.31658 WP_000349895.1.31940 WP_000349895.1.31967 WP_000349895.1.31972 WP_000349895.1.32192 WP_000349895.1.32206 WP_000349895.1.32438 WP_000349895.1.32515 WP_000349895.1.32527 WP_000349895.1.32660 WP_000349895.1.32702 WP_000349895.1.32714 WP_000349895.1.32786 WP_000349895.1.32804 WP_000349895.1.32860 WP_000349895.1.32907 WP_000349895.1.33030 WP_000349895.1.33127 WP_000349895.1.33143 WP_000349895.1.33248 WP_000349895.1.33261 WP_000349895.1.333 WP_000349895.1.33492 WP_000349895.1.33553 WP_000349895.1.33592 WP_000349895.1.33894 WP_000349895.1.34043 WP_000349895.1.34075 WP_000349895.1.34257 WP_000349895.1.34279 WP_000349895.1.34319 WP_000349895.1.34453 WP_000349895.1.34610 WP_000349895.1.34856 WP_000349895.1.34975 WP_000349895.1.34977 WP_000349895.1.35045 WP_000349895.1.35129 WP_000349895.1.35184 WP_000349895.1.35404 WP_000349895.1.35408 WP_000349895.1.35425 WP_000349895.1.35429 WP_000349895.1.35446 WP_000349895.1.35463 WP_000349895.1.35503 WP_000349895.1.35509 WP_000349895.1.35590 WP_000349895.1.35940 WP_000349895.1.36003 WP_000349895.1.3601 WP_000349895.1.36609 WP_000349895.1.36690 WP_000349895.1.3670 WP_000349895.1.36705 WP_000349895.1.36918 WP_000349895.1.36931 WP_000349895.1.37073 WP_000349895.1.37111 WP_000349895.1.37112 WP_000349895.1.37256 WP_000349895.1.37293 WP_000349895.1.37370 WP_000349895.1.37376 WP_000349895.1.3744 WP_000349895.1.37498 WP_000349895.1.37504 WP_000349895.1.37618 WP_000349895.1.37687 WP_000349895.1.37968 WP_000349895.1.37978 WP_000349895.1.38125 WP_000349895.1.38145 WP_000349895.1.383 WP_000349895.1.3848 WP_000349895.1.38613 WP_000349895.1.38673 WP_000349895.1.3869 WP_000349895.1.38693 WP_000349895.1.38773 WP_000349895.1.38882 WP_000349895.1.38913 WP_000349895.1.39003 WP_000349895.1.39136 WP_000349895.1.39197 WP_000349895.1.39229 WP_000349895.1.39405 WP_000349895.1.39420 WP_000349895.1.39449 WP_000349895.1.39512 WP_000349895.1.39556 WP_000349895.1.39629 WP_000349895.1.39763 WP_000349895.1.39862 WP_000349895.1.39921 WP_000349895.1.39923 WP_000349895.1.40017 WP_000349895.1.40072 WP_000349895.1.40073 WP_000349895.1.4011 WP_000349895.1.40208 WP_000349895.1.40240 WP_000349895.1.40257 WP_000349895.1.40292 WP_000349895.1.40305 WP_000349895.1.40380 WP_000349895.1.40395 WP_000349895.1.40465 WP_000349895.1.40710 WP_000349895.1.4075 WP_000349895.1.4087 WP_000349895.1.40877 WP_000349895.1.41017 WP_000349895.1.41086 WP_000349895.1.41091 WP_000349895.1.41226 WP_000349895.1.41279 WP_000349895.1.41516 WP_000349895.1.41554 WP_000349895.1.41572 WP_000349895.1.41591 WP_000349895.1.41662 WP_000349895.1.41708 WP_000349895.1.41761 WP_000349895.1.41859 WP_000349895.1.41882 WP_000349895.1.41979 WP_000349895.1.41985 WP_000349895.1.42104 WP_000349895.1.42320 WP_000349895.1.42342 WP_000349895.1.42422 WP_000349895.1.4276 WP_000349895.1.42864 WP_000349895.1.4288 WP_000349895.1.43018 WP_000349895.1.43041 WP_000349895.1.43244 WP_000349895.1.43312 WP_000349895.1.43334 WP_000349895.1.43351 WP_000349895.1.43437 WP_000349895.1.43522 WP_000349895.1.43613 WP_000349895.1.43668 WP_000349895.1.43886 WP_000349895.1.44005 WP_000349895.1.44043 WP_000349895.1.44099 WP_000349895.1.44121 WP_000349895.1.44291 WP_000349895.1.44310 WP_000349895.1.44479 WP_000349895.1.44640 WP_000349895.1.4467 WP_000349895.1.44747 WP_000349895.1.4485 WP_000349895.1.44877 WP_000349895.1.44927 WP_000349895.1.44971 WP_000349895.1.45067 WP_000349895.1.45074 WP_000349895.1.45079 WP_000349895.1.45098 WP_000349895.1.45177 WP_000349895.1.45184 WP_000349895.1.45259 WP_000349895.1.45344 WP_000349895.1.45349 WP_000349895.1.45365 WP_000349895.1.45550 WP_000349895.1.45585 WP_000349895.1.45660 WP_000349895.1.45690 WP_000349895.1.45797 WP_000349895.1.458 WP_000349895.1.46011 WP_000349895.1.46069 WP_000349895.1.46112 WP_000349895.1.46173 WP_000349895.1.46174 WP_000349895.1.46187 WP_000349895.1.46303 WP_000349895.1.46595 WP_000349895.1.46675 WP_000349895.1.46930 WP_000349895.1.47057 WP_000349895.1.47214 WP_000349895.1.47429 WP_000349895.1.47448 WP_000349895.1.4747 WP_000349895.1.47472 WP_000349895.1.47478 WP_000349895.1.47621 WP_000349895.1.47799 WP_000349895.1.48242 WP_000349895.1.48253 WP_000349895.1.483 WP_000349895.1.48367 WP_000349895.1.48377 WP_000349895.1.4853 WP_000349895.1.48788 WP_000349895.1.4885 WP_000349895.1.48876 WP_000349895.1.48894 WP_000349895.1.48919 WP_000349895.1.49084 WP_000349895.1.49155 WP_000349895.1.49204 WP_000349895.1.49239 WP_000349895.1.49256 WP_000349895.1.49290 WP_000349895.1.49340 WP_000349895.1.49366 WP_000349895.1.49490 WP_000349895.1.49515 WP_000349895.1.49572 WP_000349895.1.4979 WP_000349895.1.49803 WP_000349895.1.49805 WP_000349895.1.49929 WP_000349895.1.50080 WP_000349895.1.50161 WP_000349895.1.50211 WP_000349895.1.50376 WP_000349895.1.50389 WP_000349895.1.50676 WP_000349895.1.50804 WP_000349895.1.50808 WP_000349895.1.5088 WP_000349895.1.50908 WP_000349895.1.50941 WP_000349895.1.51014 WP_000349895.1.51022 WP_000349895.1.51179 WP_000349895.1.51182 WP_000349895.1.51186 WP_000349895.1.51487 WP_000349895.1.51488 WP_000349895.1.51634 WP_000349895.1.51649 WP_000349895.1.51686 WP_000349895.1.51756 WP_000349895.1.51911 WP_000349895.1.51932 WP_000349895.1.51989 WP_000349895.1.52121 WP_000349895.1.52148 WP_000349895.1.52346 WP_000349895.1.52353 WP_000349895.1.52361 WP_000349895.1.52653 WP_000349895.1.52656 WP_000349895.1.52743 WP_000349895.1.52857 WP_000349895.1.52898 WP_000349895.1.52915 WP_000349895.1.53190 WP_000349895.1.53406 WP_000349895.1.53436 WP_000349895.1.53466 WP_000349895.1.53529 WP_000349895.1.53543 WP_000349895.1.53757 WP_000349895.1.53812 WP_000349895.1.54033 WP_000349895.1.54075 WP_000349895.1.54196 WP_000349895.1.542 WP_000349895.1.54209 WP_000349895.1.54271 WP_000349895.1.54273 WP_000349895.1.54274 WP_000349895.1.54319 WP_000349895.1.54364 WP_000349895.1.54400 WP_000349895.1.54644 WP_000349895.1.54662 WP_000349895.1.54722 WP_000349895.1.54749 WP_000349895.1.54764 WP_000349895.1.55008 WP_000349895.1.55152 WP_000349895.1.55156 WP_000349895.1.55285 WP_000349895.1.55475 WP_000349895.1.55647 WP_000349895.1.55743 WP_000349895.1.55768 WP_000349895.1.55782 WP_000349895.1.55796 WP_000349895.1.55993 WP_000349895.1.56002 WP_000349895.1.56012 WP_000349895.1.56105 WP_000349895.1.56238 WP_000349895.1.56286 WP_000349895.1.56304 WP_000349895.1.56414 WP_000349895.1.56438 WP_000349895.1.56560 WP_000349895.1.56597 WP_000349895.1.56601 WP_000349895.1.56614 WP_000349895.1.56671 WP_000349895.1.56682 WP_000349895.1.56875 WP_000349895.1.56877 WP_000349895.1.57168 WP_000349895.1.57187 WP_000349895.1.57232 WP_000349895.1.57377 WP_000349895.1.57418 WP_000349895.1.57433 WP_000349895.1.57515 WP_000349895.1.57529 WP_000349895.1.57576 WP_000349895.1.57601 WP_000349895.1.57607 WP_000349895.1.57763 WP_000349895.1.57862 WP_000349895.1.57890 WP_000349895.1.57891 WP_000349895.1.57978 WP_000349895.1.5801 WP_000349895.1.58041 WP_000349895.1.58418 WP_000349895.1.5854 WP_000349895.1.58548 WP_000349895.1.5858 WP_000349895.1.58662 WP_000349895.1.58669 WP_000349895.1.58745 WP_000349895.1.58803 WP_000349895.1.5886 WP_000349895.1.59094 WP_000349895.1.59224 WP_000349895.1.59375 WP_000349895.1.59458 WP_000349895.1.59490 WP_000349895.1.59508 WP_000349895.1.5953 WP_000349895.1.59684 WP_000349895.1.59694 WP_000349895.1.59771 WP_000349895.1.5979 WP_000349895.1.59953 WP_000349895.1.60008 WP_000349895.1.60021 WP_000349895.1.60069 WP_000349895.1.60106 WP_000349895.1.60140 WP_000349895.1.60155 WP_000349895.1.60285 WP_000349895.1.60379 WP_000349895.1.60464 WP_000349895.1.60874 WP_000349895.1.60941 WP_000349895.1.61078 WP_000349895.1.6114 WP_000349895.1.61232 WP_000349895.1.6129 WP_000349895.1.61296 WP_000349895.1.61345 WP_000349895.1.61417 WP_000349895.1.61574 WP_000349895.1.61609 WP_000349895.1.61712 WP_000349895.1.61714 WP_000349895.1.61730 WP_000349895.1.61857 WP_000349895.1.61918 WP_000349895.1.61952 WP_000349895.1.62007 WP_000349895.1.62025 WP_000349895.1.62204 WP_000349895.1.62304 WP_000349895.1.62364 WP_000349895.1.62374 WP_000349895.1.62403 WP_000349895.1.6253 WP_000349895.1.62570 WP_000349895.1.62853 WP_000349895.1.62903 WP_000349895.1.62910 WP_000349895.1.62955 WP_000349895.1.63063 WP_000349895.1.63181 WP_000349895.1.63203 WP_000349895.1.63256 WP_000349895.1.63290 WP_000349895.1.63382 WP_000349895.1.63432 WP_000349895.1.63461 WP_000349895.1.63479 WP_000349895.1.63577 WP_000349895.1.63664 WP_000349895.1.63718 WP_000349895.1.6375 WP_000349895.1.63757 WP_000349895.1.63834 WP_000349895.1.64046 WP_000349895.1.6423 WP_000349895.1.64244 WP_000349895.1.64403 WP_000349895.1.64649 WP_000349895.1.64702 WP_000349895.1.64757 WP_000349895.1.64781 WP_000349895.1.64831 WP_000349895.1.6489 WP_000349895.1.65018 WP_000349895.1.65028 WP_000349895.1.65171 WP_000349895.1.65248 WP_000349895.1.6535 WP_000349895.1.65474 WP_000349895.1.65572 WP_000349895.1.65633 WP_000349895.1.6565 WP_000349895.1.65696 WP_000349895.1.6575 WP_000349895.1.65782 WP_000349895.1.6630 WP_000349895.1.66314 WP_000349895.1.66358 WP_000349895.1.66362 WP_000349895.1.6638 WP_000349895.1.6640 WP_000349895.1.66698 WP_000349895.1.6680 WP_000349895.1.66834 WP_000349895.1.66901 WP_000349895.1.66962 WP_000349895.1.67037 WP_000349895.1.67045 WP_000349895.1.67181 WP_000349895.1.67268 WP_000349895.1.67347 WP_000349895.1.67465 WP_000349895.1.67552 WP_000349895.1.67682 WP_000349895.1.67829 WP_000349895.1.67887 WP_000349895.1.68073 WP_000349895.1.68201 WP_000349895.1.68206 WP_000349895.1.6827 WP_000349895.1.68275 WP_000349895.1.6849 WP_000349895.1.68547 WP_000349895.1.68589 WP_000349895.1.68655 WP_000349895.1.68656 WP_000349895.1.68778 WP_000349895.1.68787 WP_000349895.1.68894 WP_000349895.1.68928 WP_000349895.1.68975 WP_000349895.1.69006 WP_000349895.1.6913 WP_000349895.1.69146 WP_000349895.1.69255 WP_000349895.1.69397 WP_000349895.1.69564 WP_000349895.1.69644 WP_000349895.1.69704 WP_000349895.1.7021 WP_000349895.1.70241 WP_000349895.1.70269 WP_000349895.1.70289 WP_000349895.1.70447 WP_000349895.1.70485 WP_000349895.1.70643 WP_000349895.1.70683 WP_000349895.1.70883 WP_000349895.1.70922 WP_000349895.1.70948 WP_000349895.1.71116 WP_000349895.1.71146 WP_000349895.1.71165 WP_000349895.1.71188 WP_000349895.1.71202 WP_000349895.1.71243 WP_000349895.1.71306 WP_000349895.1.71337 WP_000349895.1.7134 WP_000349895.1.71378 WP_000349895.1.71401 WP_000349895.1.71691 WP_000349895.1.71702 WP_000349895.1.71750 WP_000349895.1.71756 WP_000349895.1.71845 WP_000349895.1.71881 WP_000349895.1.71908 WP_000349895.1.71952 WP_000349895.1.71973 WP_000349895.1.72105 WP_000349895.1.72203 WP_000349895.1.72372 WP_000349895.1.72376 WP_000349895.1.72594 WP_000349895.1.72871 WP_000349895.1.72975 WP_000349895.1.73062 WP_000349895.1.7315 WP_000349895.1.73200 WP_000349895.1.7334 WP_000349895.1.73377 WP_000349895.1.73481 WP_000349895.1.7356 WP_000349895.1.73561 WP_000349895.1.73581 WP_000349895.1.73617 WP_000349895.1.73667 WP_000349895.1.73753 WP_000349895.1.73758 WP_000349895.1.73794 WP_000349895.1.7387 WP_000349895.1.73924 WP_000349895.1.73926 WP_000349895.1.74029 WP_000349895.1.74049 WP_000349895.1.74181 WP_000349895.1.74191 WP_000349895.1.7433 WP_000349895.1.74379 WP_000349895.1.74410 WP_000349895.1.74466 WP_000349895.1.74529 WP_000349895.1.74545 WP_000349895.1.74745 WP_000349895.1.75129 WP_000349895.1.75187 WP_000349895.1.75288 WP_000349895.1.75334 WP_000349895.1.75362 WP_000349895.1.75385 WP_000349895.1.75392 WP_000349895.1.75760 WP_000349895.1.75764 WP_000349895.1.75837 WP_000349895.1.75874 WP_000349895.1.75945 WP_000349895.1.76020 WP_000349895.1.76252 WP_000349895.1.76445 WP_000349895.1.7660 WP_000349895.1.76673 WP_000349895.1.76706 WP_000349895.1.76721 WP_000349895.1.76756 WP_000349895.1.76760 WP_000349895.1.76875 WP_000349895.1.76880 WP_000349895.1.76899 WP_000349895.1.77038 WP_000349895.1.77047 WP_000349895.1.77080 WP_000349895.1.7712 WP_000349895.1.77180 WP_000349895.1.77244 WP_000349895.1.77292 WP_000349895.1.77349 WP_000349895.1.77514 WP_000349895.1.77529 WP_000349895.1.77549 WP_000349895.1.77692 WP_000349895.1.7782 WP_000349895.1.77851 WP_000349895.1.77898 WP_000349895.1.77918 WP_000349895.1.77960 WP_000349895.1.78076 WP_000349895.1.78096 WP_000349895.1.78100 WP_000349895.1.78110 WP_000349895.1.78120 WP_000349895.1.78383 WP_000349895.1.78407 WP_000349895.1.7861 WP_000349895.1.78618 WP_000349895.1.78673 WP_000349895.1.78735 WP_000349895.1.78802 WP_000349895.1.78830 WP_000349895.1.78835 WP_000349895.1.78871 WP_000349895.1.78874 WP_000349895.1.78918 WP_000349895.1.78930 WP_000349895.1.79151 WP_000349895.1.79167 WP_000349895.1.79335 WP_000349895.1.79462 WP_000349895.1.79472 WP_000349895.1.79490 WP_000349895.1.79495 WP_000349895.1.79529 WP_000349895.1.79570 WP_000349895.1.7964 WP_000349895.1.79659 WP_000349895.1.79668 WP_000349895.1.79708 WP_000349895.1.79845 WP_000349895.1.80077 WP_000349895.1.80137 WP_000349895.1.80182 WP_000349895.1.80296 WP_000349895.1.80366 WP_000349895.1.80780 WP_000349895.1.80831 WP_000349895.1.80850 WP_000349895.1.80881 WP_000349895.1.80939 WP_000349895.1.8096 WP_000349895.1.81037 WP_000349895.1.81069 WP_000349895.1.81149 WP_000349895.1.81175 WP_000349895.1.8119 WP_000349895.1.81193 WP_000349895.1.81354 WP_000349895.1.81410 WP_000349895.1.81425 WP_000349895.1.81750 WP_000349895.1.81785 WP_000349895.1.81902 WP_000349895.1.81974 WP_000349895.1.82337 WP_000349895.1.82479 WP_000349895.1.82503 WP_000349895.1.82515 WP_000349895.1.82676 WP_000349895.1.82761 WP_000349895.1.8282 WP_000349895.1.82944 WP_000349895.1.82956 WP_000349895.1.83092 WP_000349895.1.83163 WP_000349895.1.83305 WP_000349895.1.83365 WP_000349895.1.83413 WP_000349895.1.83491 WP_000349895.1.83523 WP_000349895.1.8354 WP_000349895.1.83721 WP_000349895.1.83760 WP_000349895.1.83995 WP_000349895.1.84103 WP_000349895.1.84283 WP_000349895.1.84392 WP_000349895.1.8441 WP_000349895.1.84532 WP_000349895.1.84659 WP_000349895.1.84693 WP_000349895.1.84899 WP_000349895.1.8497 WP_000349895.1.85040 WP_000349895.1.85134 WP_000349895.1.85178 WP_000349895.1.85190 WP_000349895.1.8533 WP_000349895.1.8545 WP_000349895.1.85481 WP_000349895.1.85483 WP_000349895.1.85541 WP_000349895.1.8556 WP_000349895.1.85615 WP_000349895.1.85617 WP_000349895.1.85663 WP_000349895.1.85671 WP_000349895.1.85672 WP_000349895.1.85777 WP_000349895.1.85855 WP_000349895.1.85886 WP_000349895.1.85900 WP_000349895.1.85904 WP_000349895.1.85976 WP_000349895.1.86306 WP_000349895.1.86356 WP_000349895.1.86450 WP_000349895.1.86469 WP_000349895.1.86580 WP_000349895.1.86588 WP_000349895.1.86661 WP_000349895.1.8672 WP_000349895.1.8678 WP_000349895.1.86810 WP_000349895.1.8684 WP_000349895.1.86895 WP_000349895.1.86906 WP_000349895.1.87095 WP_000349895.1.87323 WP_000349895.1.8736 WP_000349895.1.87460 WP_000349895.1.87552 WP_000349895.1.87779 WP_000349895.1.87945 WP_000349895.1.88019 WP_000349895.1.88073 WP_000349895.1.8809 WP_000349895.1.88291 WP_000349895.1.88293 WP_000349895.1.8837 WP_000349895.1.88393 WP_000349895.1.88703 WP_000349895.1.88792 WP_000349895.1.88902 WP_000349895.1.8891 WP_000349895.1.88981 WP_000349895.1.89008 WP_000349895.1.89116 WP_000349895.1.89138 WP_000349895.1.89304 WP_000349895.1.89512 WP_000349895.1.89527 WP_000349895.1.89570 WP_000349895.1.89604 WP_000349895.1.89622 WP_000349895.1.89659 WP_000349895.1.89902 WP_000349895.1.8996 WP_000349895.1.90097 WP_000349895.1.90252 WP_000349895.1.90417 WP_000349895.1.90453 WP_000349895.1.90458 WP_000349895.1.90557 WP_000349895.1.90585 WP_000349895.1.90641 WP_000349895.1.90734 WP_000349895.1.91003 WP_000349895.1.91069 WP_000349895.1.91278 WP_000349895.1.9131 WP_000349895.1.91512 WP_000349895.1.91564 WP_000349895.1.91628 WP_000349895.1.91655 WP_000349895.1.91724 WP_000349895.1.91788 WP_000349895.1.92013 WP_000349895.1.92060 WP_000349895.1.92093 WP_000349895.1.92108 WP_000349895.1.92171 WP_000349895.1.92183 WP_000349895.1.92208 WP_000349895.1.92268 WP_000349895.1.92310 WP_000349895.1.92318 WP_000349895.1.92443 WP_000349895.1.92482 WP_000349895.1.92531 WP_000349895.1.92562 WP_000349895.1.92669 WP_000349895.1.92671 WP_000349895.1.92738 WP_000349895.1.93101 WP_000349895.1.93136 WP_000349895.1.93155 WP_000349895.1.93275 WP_000349895.1.93365 WP_000349895.1.93376 WP_000349895.1.93543 WP_000349895.1.93650 WP_000349895.1.93656 WP_000349895.1.93662 WP_000349895.1.937 WP_000349895.1.93705 WP_000349895.1.93804 WP_000349895.1.9389 WP_000349895.1.93994 WP_000349895.1.94072 WP_000349895.1.94162 WP_000349895.1.94168 WP_000349895.1.94198 WP_000349895.1.9432 WP_000349895.1.94354 WP_000349895.1.94380 WP_000349895.1.94458 WP_000349895.1.94565 WP_000349895.1.94584 WP_000349895.1.94674 WP_000349895.1.94796 WP_000349895.1.94959 WP_000349895.1.95051 WP_000349895.1.95085 WP_000349895.1.95121 WP_000349895.1.95282 WP_000349895.1.95546 WP_000349895.1.95630 WP_000349895.1.95911 WP_000349895.1.96139 WP_000349895.1.96317 WP_000349895.1.96343 WP_000349895.1.9644 WP_000349895.1.96469 WP_000349895.1.96497 WP_000349895.1.96500 WP_000349895.1.96555 WP_000349895.1.96563 WP_000349895.1.96732 WP_000349895.1.96771 WP_000349895.1.97015 WP_000349895.1.97145 WP_000349895.1.97190 WP_000349895.1.97318 WP_000349895.1.97369 WP_000349895.1.97597 WP_000349895.1.97613 WP_000349895.1.97620 WP_000349895.1.97727 WP_000349895.1.97732 WP_000349895.1.97736 WP_000349895.1.9775 WP_000349895.1.97846 WP_000349895.1.98006 WP_000349895.1.98019 WP_000349895.1.98022 WP_000349895.1.98110 WP_000349895.1.98146 WP_000349895.1.98219 WP_000349895.1.9841 WP_000349895.1.98495 WP_000349895.1.98531 WP_000349895.1.98577 WP_000349895.1.98627 WP_000349895.1.98676 WP_000349895.1.98677 WP_000349895.1.98760 WP_000349895.1.98843 WP_000349895.1.9898 WP_000349895.1.99098 WP_000349895.1.99184 WP_000349895.1.99267 WP_000349895.1.99276 WP_000349895.1.99646 WP_000349895.1.99657 WP_000349895.1.99660 WP_000349895.1.99712 WP_000349895.1.99813 WP_000349895.1.99858 WP_000349895.1.99889 WP_000349895.1.99958 ABAM02000001|CDS_4000769-4002142 ABAO01000042|CDS_25199-26572 AE006468|CDS_3627468-3628841 CP001363|CDS_3641327-3642700 FN424405|CDS_3650567-3651940 gi|525840390|ref|YP_008257907.1| gi|383498120|ref|YP_005398809.1| gi|378986072|ref|YP_005249228.1| gi|378990782|ref|YP_005253946.1| gi|378452313|ref|YP_005239673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]