SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pjtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pjtA
Domain Number 1 Region: 215-449
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3e-144
Family Tetrapyrrole methylase 0.00000218
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.05e-28
Family Siroheme synthase N-terminal domain-like 0.00000121
Further Details:      
 
Domain Number 3 Region: 114-208
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.24e-26
Family Siroheme synthase middle domains-like 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pjtA   PDB: 1pjt
Sequence length 457
Comment (A:)
Sequence
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfimpsiidrs
plmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmgerrrfwe
kffvndrlaqslanadekavnatterlfsepldhrgevvlvgagpgdaglltlkglqqiq
qadivvydrlvsddimnlvrrdadrvfvgkragyhcvpqeeinqillreaqkgkrvvrlk
ggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgiplthrdyaqsvrlvtghl
ktggeldwenlaaekqtlvfymglnqaatiqekliafgmqadmpvalvengtsvkqrvvh
gvltqlgelaqqvespaliivgrvvalrdklnwfsnh
Download sequence
Identical sequences 1pjtA 1pjt_A 1pjt_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]