SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pl5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pl5A
Domain Number 1 Region: 56-130
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 2.05e-44
Family Dimerization motif of sir4 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pl5A   PDB: 1pl5   SUPERFAMILY: 1pl5A
Sequence length 142
Comment (A:)
Sequence
sntteiltsvdvlgthsqtgtqqsnmytstqkteleidnkdsvtecskdmkedglsfvdi
vlskaasaldekekqlavaneiirslsdevmrneiritslqgdltftkkclenarsqise
kdakinklmekdfqvnkeikpy
Download sequence
Identical sequences 1pl5_A 1pl5_S 1pl5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]