SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pnoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pnoA
Domain Number 1 Region: 10-179
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.12e-142
Family Transhydrogenase domain III (dIII) 0.0000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pnoA   PDB: 1pno   SUPERFAMILY: 1pnoA
Sequence length 180
Comment (A:)
Sequence
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Download sequence
Identical sequences 1pnoA 1pno_A 1pno_B 1pnq_A 1pnq_B cath|current|1pnoA00/285-464 cath|current|1pnoB00/288-464 cath|current|1pnqA00/285-464 cath|current|1pnqB00/288-464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]