SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pnuM from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pnuM
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Translational machinery components 3.51e-43
Family Ribosomal protein L18 and S11 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1pnuM   PDB: 1pnu   SUPERFAMILY: 1pnuM
Sequence length 111
Comment (M:)
Sequence
attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
Download sequence
Identical sequences 4v49_BM 4v4a_BM 4v4g_BP 4v4g_DP 4v4g_FP 4v4g_HP 4v4g_JP 1pnuM 001950337|e4v4gBP1|2484.1.1.405|BP:1-111 001950338|e4v4gDP1|2484.1.1.405|DP:1-111 001950339|e4v4gFP1|2484.1.1.405|FP:1-111 001950340|e4v4gHP1|2484.1.1.405|HP:1-111 001950341|e4v4gJP1|2484.1.1.405|JP:1-111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]